Google
 

Trailing-Edge - PDP-10 Archives - integ_tools_tops20_v7_30-apr-86_dumper - tools/transfort_v1_5/transfort.exe
There are 2 other files named transfort.exe in the archive. Click here to see a list.
?p@@*$@2/I@BCgN@U?hXLo?x+I{
 6Q1V+L0v+P 4"NQ"`,~ R Q+j3 Q+j3<<AF6Z1v+Y1V+Y6Z0V+Xd"p ,~ Z+j3,~<<C 
 6o1V+_0v+b  4$b0d?+b ,~6o0V+i@@ d&p JPd"p:l" d",~6o0V+n@@d"p:l" d",~ o+j5<<Cd"pl"p,~ 
$vbDwnw3D+v+x,~|~> Bx,j6 B 
x Ld"pl">,~60V+d"p 	JP,~ +j2<<F> Bx60V+ @ @ @~ d&p 
$bDn D~ ,j8 B xd$p D @~@@~ 
~2l~+ ~ :l" d" ~. B:~+ d"pl"+ >}+j8>},~<x<F> Bx650V+3 @ @ @~ @~ d&p 
$6bD6n7 D~ ,j9 B xd$p D @}@@} 
}2l~+1 }. ,j4  } :l" df:}+) d"pl"@+4 7>}+j:>},~<x<H> Bx2B+< R+P6Q0V+N @ @,j; > D ,j9 B @~@@~ 
~2l+L x ,j4  ~ :l" df x  Bx:~+C d"pl"@+P Q>~+j;>~,~<<I8> Bx6f0V+d @ @  D d(p 
 &gbFgnh F @~ F~7 ~+c ~ xd"p:l" d" ,j< B>~+\ +e h>~+j8>~,~<x<K> Bx6}1V+m2B+{ @ @,j; > D ,j8 B @~@@~ 
~2l+y ~. x  B x  Fx:~+r d"pl"+| ~>~+j;>~,~<<L> Bx60V+ @ @  D d(p 
 &bFnF@~jF~7~+ + >~+j:>~,~<x<LSubscript %r in GetV is out of range> Bx D @ @~6-0V+*6-1V+0v+( d&p F D~4$& 
(.bH.n/2d+& .F +, 0,j>>~+j? / >~+j? />~+j:>~,~<<x<MSubscript %r in PutV is out of range> Bx D F @~ @~6J0V+H6K1V+<0v+F d(p H~ D~4$D 
 *KbJLn
L2d+D.H  B+I M,j>>}+j? M >}+j? M>}+j:>},~<<x<O06T0V+S d$p 
"UbBUnV,~ ,~<x"Z1B+Y ,~ 
9,~<Subscript %r in EGETV is out of range> Bx D @ @~,jA3B+s6v1V+f0v+q xd$p D 
 L~7 ~+o 
&wbFwnx3&~+o ~.D +u  y,j>>~+j? x >~+j? x x>~+j:>~,~<x<P[Subscript %r in Eputv is out of range> Bx D F @~ @~,jA3B+61V+0v+ xd$p D~ 
 L~7 ~+ 
&bFn3&~+ ~.D  B +  ,j>>}+j?  >}+j?  x>}+j:>},~<x<Qy,>,jA3B+ xd$p 
" bB!n!+ >,~x> Bx D @ @~adp+( ^ >~+j? d&p F(\ H~ 0"0b+0++@0@0@G@@@9@O+Y 
*\bJ]n
]3d+5 ^ x>~+jC :>~l" d",~ 
*\bJ]n
]3d+> ^ x>~+jC .F +[ 
*\bJ]n
]3d+E ^ x>~+jC .F +[ 
*\bJ]n
]3d+L ^ x>~+jC :>~l"@d",~ D~6`~+R +W x  Bx6\1V+V ^ ,jC>~+P x +[ ^ x>~+jD>~,~<x<R> Bx D F @~ @~adp+e  >}+j? d(p H~* J~ 0"0b+m+h@m@m@@}@v@
+ 
 "bBn3d+r  x>}+jC :l" df + 
 "bBn3d+{  x>}+jC.H F + 
 "bBn3d+  x>}+jC.H F + 
 "bBn3d+	  x>}+jC :l"@df + D~6`~+ + x  Bx61V+  ,jC>~+
 L8 +  x>}+jD>},~<x<S.D:+jE> Bx D F @~ @~ @}adp+% 4 >|+j?afp+( 4 >|+j? /> H~2(1+- 4 >|+jC"10"0b+3+.@3@3@|@g@R@+. xd"p 
*2bJ2n
3 J~ >3b+; 4  x>|+jC ,j9 B} xd$p D @}@@} 
}3l~+B@@+J }. :l" d"  } }:l" df:}+?"31B+M1B+O+Q }d"pl"@+0 }d"pl"P+0 +0 xd"p 
*2bJ2n
3 J~ >3b+Z 4  x>|+jC ,j8 B} xd$p D @}@@} 
}3l~+`@@+e }.} }.. 
 L:}+^ }d"pl"+0 xd"p 
*2bJ2n
3 J~ >3b+o 4  x>|+jC ,jF B} xd$p D @}@@} 
}3l~+u@@+z }.} }.. 
 L:}+s }d"pl"p+0 xd"p 
*2bJ2n
3 J~ >3b+ 4  x>|+jC ,jF B} xd$p D @}@@} 
}3l~+
@@+ }. :l"@d"  } }:l"@df:}+ }d"pl"`+0 @}Z, L} 
}3l+@@+630V+ x  Bx+ 4  x,jC:}+ ,jG B} @}@@} 
}3l~+$@@+,630V+) x  },jG x  Bx++ 4  x,jC:}+! } +0 4 x>|+jD>|,~<x<x<T.D:+jH> Bx D F H~ @~ @} @} @|adp+> c >{+j?afp+A c >{+j? 
/
> J~2*_+F c >{+jC"_0"0b+L+G@L@L@!@@l@?+\6`1V+Q6`1V+Q c >{+j8 xd$p 
"`bBana B} d"p B| 
"`bBana B} >3b}+] c  x,jC+]3J}+a c  ,jC+] D @|@@| 
|2l~+] | |:l" d"  |. :l" df:|+b6`1V+o c >{+j: xd$p 
"`bBana B} d"p B| 
"`bBana B} >3b}+{ c  x,jC+]3J}+ c  ,jC+] D @|@@| 
|2l~+] |.. |.| 
 L:|+6`1V+
 c >{+j: xd$p 
"`bBana B} d"p B| 
"`bBana B} >3b}+ c  x,jC+]3J}+ c  ,jC+] D @|@@| 
|2l~+] |.. |.| 
 L:|+6`1V+$ c >{+j: xd$p 
"`bBana B} d"p B| 
"`bBana B} >3b}+0 c  x,jC+]3J}+4 c  ,jC+] D @|@@| 
|2l~+] | |:l"@d"  |. :l"@df:|+56`1V+C3H+C c >{+j; @|Z, L| 
|2l+M6b0V+J x  Bx+L c  x,jC:|+E 
~ L| @|@@| 
|2l~+]6b0V+Y6b0V+Y x 
| 
0 L8 x  Bx |  D|+[ c  x,jC:|+O c x,jD ~>{,~<<x<x<|<W> Bx D @ @~ @~ @} @}"0"0b+m+h@o@o@a@?@@1B++61V+t61V+t  >|+j8 xd&p F~ d(p H} 
*bJn
 J 
 "bBn B~.J:,j9 B} xd$p D~ d&p F} @|@@| 
|3l+@@+
 | ~:l" d"  | }:l" df:|+ @|@@| 
|3l~+@@+p|@}:l""d"|.:}:l"df:|+d(p H} 
*bJn
 J 
 "bBn B~.J:,j8 B} xd$p D~ d&p F} @|@@| 
|3l+1@@+5 |.} |.~ 
 L:|+/ @|@@| 
|3l~+9@@+= |..} |.} 
 L:|+6 }d"pl"+61V+C  >|+j: xd&p F~ d(p H} 
*bJn
 J 
 "bBn B~.J:,jF B} xd$p D~ d&p F} @|@@| 
|3l+S@@+W |.} |.~ 
 L:|+Q @|@@| 
|3l~+[@@+_ |..} |.} 
 L:|+X }d"pl"p+61V+e  >|+j: xd&p F~ d(p H} 
*bJn
 J 
 "bBn B~.J:,jF B} xd$p D~ d&p F} @|@@| 
|3l+u@@+} | ~:l"@d"  | }:l"@df:|+s @|@@| 
|3l~+@@+	|j}:l"@d"j|.:}:l"@df:|+~}d"pl"`+3@x+@@@@@@#1B+"+( d$p 
"*bB+n+,~O@,~ O@6,0V+':   +$ ,~ , +jD<x<<Y611V+0 ,~ 
9,~<3B+4 ,~ 
9,~691V+8 ,~ 
9,~<6=1V+< ,~ 
9,~<6B1V+A ,~ 
9,~<6F1V+E ,~ 
9,~<6K1V+J ,~ 
9,~<6O1V+N ,~ 
9,~<2B+R ,~6V0V+U ,~ V+j;<<]2B+Y ,~6]0V+\ ,~ ]+j;<<^6b0V+a D,~ b+j;<<^6g0V+f D,~ g+j;<<_6m1v+l1V+l ,~ 
9,~< 6z1V+q +q 
93B+y d"p 0"+v +v 
93B+y 
91d+y,~< 6	
93B+	
 d"p 0" +	 +	 
93B+	 
91d-+	 2B+	
 
90$0+		 3B+	
 
91d=+	
 ,~<@@+	6	0V+	: +	 ,~< 
3B+	 +	 
92B+	6"	71B+	(1B+	10B+	6 
96	71V+	 3B+	6 d&p d(p 3B +	# +	$ 
93B+	6 3B +	' ,~ 
9,~ 
96	71V+	+ 3B+	6 d&p d(p 3B +	0 ,~ 
9,~ 
96	71V+	4 3B+	6 +
& ,~<<> Bx D3B+	< +	< 
92B+	}"	~0"0b+	D+	?@	e@	n@	X@	J@	J@	x@	s@	E@	O+	} 
96	1V+	G 3B+	} x>+
S 
96	1V+	L 3B+	} x>+jS 
96	1V+	Q 3B+	}  x ,	83B+	}   x +	9 
96	1V+	Z 3B+	} xd&p d(p 3B +	` +	` 
93B+	} 3B +	d +	} 
9+	} 
96	1V+	g 3B+	} xd&p d(p 3B +	m +	} 
9+	} 
96	1V+	p 3B+	} x>+
& 
96	1V+	u 3B+	} x>+
& 
96	1V+	z 3B+	} x>+
: >,~<x< 3B+
 +
 
92B+
 
96
1V+
 3B+
 
96
1V+

 3B+
 +jS,~<<> @xd"p B~d$p D 
&
%bF
%n
& F 
(
%bH
%n
&3F+
 +
$@@x 
x3l+
 
9+
$ x ~:l" d" 
 x :l" d"3J+
# +
$:x+
>~,~x> 
d"p Bd$p D 
&
9bF
9n
: Fx 
(
9bH
9n
:3F+
0 +
8@@2Jx+
2 
9+
8 . . 
3L+
7 +
8:+
0>~,~x> @xd"p B~d$p D 
&
QbF
Rn
R F 
(
QbH
Rn
R3F+
D +
P@@x 
x2L+
G 
9+
P x ~:l"@d" 
 x :l"@d"3J+
O +
P:x+
D>~,~x> @~d"p Bxd$p D 
&
gbF
gn
h F 
(
gbH
gn
h3F+
\ +
f@@~ 
~3l+
_ 
9+
f ~.  ~.x ,jR2B+
e +
f:~+
]>~,~x2B+
k ,~6
n0V+
m +jU 
o+j;<<c2B+
r ,~6
u0V+
t +jU 
v+j;<<d2B+
y ,~6
|0V+
{ +jV 
}+j;<<e2B+ ,~60V+ +jV +j;<<f2B+ ,~6
0V+	 +jX +j;<<f2B+ ,~60V+ +jX +j;<<g2B+ ,~60V+ +jY +j;<<h2B+ ,~60V+ +jY  +j;<<i2B+# ,~6&0V+% +j[ '+j;<<i2B+* ,~6-0V+, +j[ .+j;<<j2B+1 ,~640V+3 +j\ 5+j;<<k2B+8 ,~6;0V+: +j\ <+j;<<l2B+? ,~6B0V+A +j^ C+j;<<l2B+F ,~6I0V+H +j^ J+j;<<m2B+M ,~6P0V+O +j_ Q+j;<<n2B+T ,~6W0V+V +j_ X+j;<<o2B+[ ,~6^0V+] +j` _+j;<<d2B+b ,~6e0V+d +j` f+j;<<e2B+i ,~6l0V+k +ja m+j;<<g2B+p ,~6s0V+r +ja t+j;<<h2B+w ,~6z0V+y +ja {+j;<<j2B+~ ,~6
0V+
 +ja 
+j;<<k2B+
 ,~6
0V+
 +jb 
	+j;<<m2B+
 ,~6
0V+
 +jb 
+j;<<n2B+
 ,~6
0V+
 ,~ 
+j;<<]2B+
 ,~6
0V+
 ,~ 
+j;<<^2B+
! ,~6
$0V+
# +jb 
%+j;<<o2B+
( ,~6
+0V+
* +jb 
,+j;<<p2B+
/ ,~6
20V+
1 +jc 
3+j;<<p2B+
6 ,~6
90V+
8 +jc 
:+j;<<q6
>0V+
= ,~ 
9,~< 6
G0V+
B +
C 
93B+
F 
96
G0V+
F ,~<<3B+
J ,~ 
9,~ 6
T1v+
P1V+
P +
P 
92B+
T 
96
U1V+
T ,~<<
Illegalarguments to Expt> Bx D @6
^0v+
`6+
g1V+
g,jfB~+,jf @~ ,jg3B+
s @~Z, L~ ~ ,jh,jh2B+
 x ,ji B ~,ji B~+
l ,jh3B+
 @~O@~ ~ ,jh O@,ji,jh2B+
 x ,jj BO@ ~,jj B~+
v >~,~<<
U<t+jk<{,,jf+B,x  +
x6+,js+x Bx+<<0+jv6
9,~++Bx6,js2B+ Bx6
93B+,js2B+jx> Bx @ @ @~61V+
  D  Bx6
0V+  B,js  F~2F+ x+
0V+ 
6 +
  >~+ju>~,~<<<<03B+ ,~ 
9,~,>,jh3B+ x>+jz x>,~Attempt to divide by 0 in DIVIDE> Bx D ,j{3B+% x,jf B ,jf   +,jf  *Z"1>~+jg  x,jj B  x,j{ >~+j|<	@@ . +j}<
,>,>,j~3B+2 +3 x>,~@@ 6 +j}<,>,>,jg3B+; +; x>,~@@ ? +j}<yZ& B +j}<x,>,>6K1V+F +J  x 
,k x  Bx+D>,~<x,>,>6U1V+P +T  x  
,k x  Bx+M>,~<x> Bx D6a1V+Z +`  
,k B  x ,V  >~+k>~,~<> Bx D6m1V+f +l 
,k B  x ,b  >~+k>~,~<> Bx D6x1V+r +w  
,k B  x ,n >~+j|>~,~<> Bx D61V+} + 
,k B  x ,y >~+j|>~,~<> Bx D61V+ + @ @~ ,jG  F~ F x  Dx60V+ x ,jG ~ B8 x  Dx ~  F~+
 L8 >~,~<<x> Bx D6&1V+ +%6&0V+#  ,jT3B+#  +%   x+>,~<<> Bx D F661V+-  
>~+k660V+2  ,jT3B+2  +5    x+(>~,~<<Different length lists in PAIR> Bx D6L0V+F6L0V+F  ,j< B   x ,; >~+j|6L1V+I6L0V+J M>~+j? >~,~<<7> Bx D6`1V+R +_ @  ,k B6`0V+W +_6a1V+Y +_   x,N B~   x,N ~>~+j|>~,~<<> Bx D6o1V+f +n     ,k x   B  x ,b >~+j|>~,~<,>,>6}1V+t +|   ,jT3B+x  +|   x,p  >+j|>,~<> Bx D61V+ + ,jT3B+ +   x+>,~<61V+
 ,~2B+ ,~ +	< 
  61V+ ,~ 60V+  + H ,~<<,>,>6#0V+!  x ,j< B x  Dx+ >,~<x> Bx D F2F+( +5  ,jT3B++ x+5661V+. +5    x,$ B~    x,$ ~>~+j|>~,~<> Bx6@1V+: +? ,js B x ,7 >+j|>,~<2B+C ,~+k
,>,>6N0V+M6N1V+I +M ,D  x  >+jf>,~<< ,~ ,~,>,>,k x,k >,~  
,jT3B+[ ,~ 
9,~2B+_ ,~ 
9,~,j~3B+c ,~ 
9,~,jg3B+g ,~ 
9,~ 6p1V+k +l 
93B+p 3B+o ,~ 
9,~<,>,>61V+u +u 
93B+z  3B
+y +z 
92B+ 
96	1V+} 2B+ x,k B61V+ + 
93B+  3B	+ + 
9>,~<<x<{<~>,k Bx61V+ + 
93B+ x 3B+ + 
9>,~<<>,k Bx6 1V+ + 
93B+ x 3B!+ + 
9>,~<<>,k Bx6,1V+& +& 
93B++ x 3B,+* ++ 
9>,~<<%r has no definition in CopyD> Bx D ,k B6;0V+8   x,jn+:  <,j>,j? x>~,~<- 0  @+jj<  B+jm<{  E+j<<]  G+j<<p  J+j<<h  L+j<<i  O+j<<^ 
  6W0V+V (   F  
+Q ,~<> Bx D F  ,jT3B+^  
x L8+c 
6i0V+c    x,k 
6j0V+h    x>~+k >~,~<0<0> Bx D F2F+o +v  ,jT3B+r x+v6w0V+v   x,X >~,~<> Bx D60V+  ,jT3B+  
 
0L+x+x>,~<,>,>61V++, x >+j|>,~<> Bx D F6(1V+ +'    
,k3B+#  +'    x,  >~+j|>~,~<600V+/ 2B8+.  
 
0 L,~ +) ,~<,>681V+4 +72B+6 +7,) x>,~<6A1V+< ,~6A0V+@ 2B8+@ ,~ +9<<> Bx D F6R1V+G +Q6R0V+N      
,k3B+N  +Q    x+C>~,~<<> Bx D F6`1V+X +_     
,k3B+] +_    x+T>~,~<> Bx D6n1V+e +m6n0V+k  ,jT3B+k  +m   x+b>,~<<,>,>6}1V+s +|6~0V+x  ,jT3B+x  +|   x,o  >+j|>,~<<> Bx D6
0V+ 
6	   ,jT3B+	  
 
0 L+   x+ >,~<<0,>,>61V+ +60V+  ,jT3B+  +  x,~ >,~<<> Bx D6.1V+ +-  B6/1V+# +# 
93B+(  3Bx+' +( 
93B+* +-  x,  >~+j|>~,~<<690V+8 
6:0V+7  82B8+7  
 
0 L,~ +/ ,~<<0,>6D1V+> +C6D0V+B 2B8+B +C,/ x>,~<<> Bx D @6X0V+J2D+K +W6X1V+R  ,k  F3F+Q +W +W ,E B~   x,E ~>~+j|>~,~<< 6b0V+a6b0V+_ 
 L 
L,~jc+ac+j;<<<,6g0V+f,k,~<6l0V+l6m0V+lj+h,~<<>jBx6v0V+u,nB x ,n >+j|>,~<,>,>,6~0V+{ +}   x>+jC>,~<<.> Bx1D+60V+ ,k  x +>,~<> Bx1D+61V+
 L+# x 8 B8 x B8 x>,~<x,>,>3D+4651V++ ,k >+j|2@+0 ,k x B8 x 
 L+4  D8 ,k x B8 x>,~<Different length lists in MAP2> Bx D F6L0V+?6L1V+@ +F   x 
,k x  Bx   D+<6L1V+I6L0V+J M>~+j? >~,~<x<5Different length lists in MAPC2> Bx D F6e0V+W6e1V+X +_    x  
,kxxBxD+T6e1V+b6e0V+cf>~+j?>~,~<x<M,>,>,k# x,k >,~  
9,~ ,~,>,k x>,~> Bx61V+ +  ,k3B+ x + x , x >+j|>,~<,>6+1V+" +*  ,k3B+& x >+k) x ,k) x >+j|>,~<,>,>,k3B+/ +1  x>+j<>,~,>,>,k3B+6 +8  x>+j<>,~> Bx D6F1V+> +E ,k3B+A +C  x ,j<  x +:>,~<> Bx D6S1V+K +R ,k3B+N +P  x ,j<  x +G>,~<> Bx D6c1V+X +b ,k3B+`  x ,k  x ,T x >+j|  x +T>,~<,>,>6s1V+g +r ,k3B+o  x ,k  x ,k, x >+j|  x >+k,>,~<Z$ Y/Y&,~2B+x+k. +|	Heap space exhausted> Bx D 
Y L.BY 
Y2,Y+
 
Y2,Y+ 
 LY3D+ 
,k/+
,k/ 
9 x+}2@Y+
 

9 LY,k0 >~,~yZ$ Y/Y&,~,>61v+1V+ ,j3 Y/x BY 
9>,~<<?2DY+ BY,~ ,~> BxZ$."& B:,k. B xd$pl$p D .B@@ >~,~> BxZ$."& B:,k2 B 
x L .B@@>~,~> Bx(B: B:,k. B xd$pl$ D>~,~> Bx.",k. B xd$pl$  D>,~> Bx.",k. B xd$pl$ D>,~>Z",k. Bx@@d$pl$ D>,~>Z",k. BxZ$d$pl$ D>,~	Ran out of ID space,>6@	+S,k46@	+S W>+k/ 
	 Lx 
x 
1JP L	 x>,~LRan out of binary program space  2B+aZ$ !/!&,~ !.B! 
!2,!+d e+j? ,~X2D!+h B!,~ ,~Ran out of WArray space  2B+qZ$ !/!&,~ !/ 2$!+u v+j?  B!,~i2B!+z  B!,~ ,~> B} D~ d&p F d(p H 
 *bJn
 J~ 
"bBn2"+ B~Z$Z".~& B~@@x 
x2l~+ x. x. 
 L:x+	 }>},~x> Bx d$p 
"bBn,j9 B xd$p,k6 d"pl"@>,~x> B Dx 
@@3h+!@@+% . .x 
 L:+ >,~> B} D~ d&p F d(p H 
 *6bJ6n
7 J~@@x 
x2l~+4 x. x. 
 L:x+/ }>},~x> Bx d$p 
"AbBAnB,j8 B xd$p,k7 d"pl">,~x> B} D~ d&p F d(p H 
 *QbJRn
R J~@@x 
x2l~+P x. x. 
 L:x+J }>},~x> Bx d$p 
"\bB]n],jF B xd$p,k8 d"pl"p>,~x> Bx @ @ @~"	0"0b+h+c@@@@m@@@@o@h+ x ,^ B~ x ,^ ~>}+j| x>}+k6 xd$p D~ 
&	bF
n
 F ,j8 d(pl( H @~@@~ 
~3l+y@@+ xd"p.~ ,^ d$p.~ B:~+w + x>}+k9 x,k9d"pd"pl"+ x,k9d"pd"pl"0+ x>},~<x> Bx D"..NYZ",k. B 
x L 
 Ld"pl">~,~ 
  YZ..NY 
Y2,Y++ B D d"pl",~ 
  YZ..NY 
Y2,Y+!  + D B d"pl",~  YZ..NY 
Y2,Y+) + B  D d"pl",~A vector with fewer than zero elements cannot be allocated> Bx6E1V+70v+C Bx2"F+: G>~+j? @,j8 B @@@ 
2lx+A .  B:+< d"pl"+D F>~+j3>~,~<<I,An  Evect with fewer than zero elements cannot be allocated> Bx D6b1V+R0v+` Bx2"c+U d>~+j? @,k2 B 
 L @~Z, L~ 
~2lx+^ ~.  B:~+Y d"pl" +a c>~+j3>~,~<<JG> Bx D @ @~6z1V+j0v+k B+l {>}+j3 
2,{+p { x>}+k< ,j9 B~@@~ 
~2l+x  ~ ~:l" df:~+r ~d"pl"@>},~<<J> Bx D @ @~61V+0v+ B+ >}+j3 
2,+  x>}+k< ,j9 B~@@~ 
~2l+  ~ ~:l" df:~+	 ~d"pl"P>},~<<K> Bx D @ @~6)1V+0v+ B+ *>}+j3 
2,*+ * x>}+k< ,jF B~@@~ 
~2l+'  ~ ~:l"@df:~+! ~d"pl"`>},~<<L> Bx D @ @~6?1V+00v+1 B+3 @>}+j3 
2,@+6 @ x>}+k< ,jF B~@@~ 
~2l+= ~.~ 
 L:~+8 ~d"pl"p>},~<<L> Bx D @ @~6U1V+F0v+G B+I V>}+j3 
2,V+L V x>}+k< ,j8 B~@@~ 
~2l+S ~.~ 
L:~+N~d"pl">},~<<M+j:+j=> Bx D F H~  ~  ,jn x>~+j|> Bx D F   ,jf x>~+j|,>,>  ,jm x>+j|,> ,jG x>+j|+k/Heap space low*** Garbage collection starting>3@
Y LY 
Y LY 
Y Lx 
Y L 
Y LY 
Y LY 
x LY 
 LY 
Y Lx 
Y LY 
xLY,,CY.$Y:,kC,kB/YBY.B,H xC,9JPl,`Z.
.x>+H> @x @Z"@,@@ 
0l?+("=1B 
0l+0C"|l"@d" B4b/$>1D
l LZ..N 
9 
3ll+5 3B+7 ,H+1 
| L 
2lY+< ,H:+8 >~,~<9JP<	JP> Bx D B@@~ 
2l+F ,H:~ ~.x." B+A >~,~+H> Bx @ @~ 
L~$bD4dN1$+V0D+T3@~+TY~d&pYF(b1Ha 
L~(c0H
~d*pdc J +a>}+j>},~<~<JP<~<Unexpected tag %w found at %w during garbage collection> Bx @ @ @~ @~ 
 L}"@0"0b+v+p@4@4@4@@<@<@4@
@v@ +< }  D~Z",k.  Fd&pl&0 } F8 d$pl$ x D8  
~ L8 }    H8@@.,HZ".>|+H },k6 }d&p  Dd$pl$0 D  x B8+? }d$p D~ 
&AbFAnB F ,j8  D~d$pl$0 ~ D8 @}@@} 
}3l+@@+ }.~ }.~ 
 LZ".D,H:}+ ~d"pl" x B8+? }d$p D~ 
&AbFAnB F ,j8  D~d$pl$0 ~ D8 @}@@} 
}3l++@@+1 }.~ }.~ 
 LZ".D,H:}+) ~d"pl"  x B8+? B~ },k9 }d&p  Dd$pl$0 D  
~lBxB8+?`}d&pC,j>>|+k/>|,~<}x<d@@0d@+HC,JPl,`Z.n:+DZ&@"k. 
xY\(k&k+l<<0F+m@@0H+o@@0f+@|@@@|@
+d"p  
+0d"p d$p  
+0d"p ,>,>,V,^,^ 
+0d$p ,>,> ,V ,^,^ 
+0 
+0,^+Non-numeric argument in arithmetic,>   x ,jf  Z"1>+jgNon-integer argument in arithmetic,>   x ,jf  !Z"1>+jgNon-integer argument in arithmetic,>  x ,jm  +Z"1>+jg"$,+-<0D+.@@,^0$0d+3+1@4@3@3@5+:d"p  
+0 
+0Non-numeric argument in arithmetic  ,jm  >Z"1+jg6$?+@<0D+A@@,^0$0d+F+D@H@G@F@I ,~d"p  
+0 
+0> Bx,j6 B 
x Ld"pl">,~
Bignums not yet supported S+j?O ,~,~ @@."Yd D@@ Y	,~,i]h<y .D   
"fbBgng3B+c +c 
93B+e ,~ +J|~> Bx D,k3 B d&p: xd$p:: d"pl"0>~,~,it<w ".B   
"~bBn3B+{ +{ 
93B+} ,~ +J|~> Bx D,k3 B d&p: xd$p::( d"pl"0>~,~,i
<x> B Dx $ 
   
"bBn3B+ + 
92B+ >+J >,~|~> Bx D,k3 B d&p: xd$p::F d"pl"0>~,~,i+E<yAttempt to divide by zero in Quotient> Bx D @5D4,jf B~ ,jf  ~ @,jf  @Z"1>~+jg& B B~ 
">bB?n?3B~+: +: 
92B+= >~+J >~,~|~'<yAttempt to divide by zero in Quotient> Bx D @ ,A3B+P x,jf B~ ,jf  ~ Y,jf  YZ"1>~+jg,k3 B d&p: xd$p::h d"pl"0>~,~A<y,iaw<
Attempt to divide by zero in Remainder> Bx D @5Dj,jf B~ ,jf  ~ v,jf  vZ"1>~+jg&  B B~ 
"tbBunu3B~+p +p 
92B+s >~+J >~,~|~\<
> Bx D,k3 B d&p: xd$p::h d&p: : F : xd$p: ( d"pl"0>~,~,i
<SA   
"bBn3B+ + 
93B+ ,~ +J|~,i<TG   
""bB#n#3B+ + 
93B+! ,~ +J|~,i&<TF   
"/bB0n03B+, +, 
93B+. ,~ +J|~,i3<U> B Dx (F 
   
"@bB@nA3B+; +< 
92B+> >+J >,~|~,iDG<v2b+F ,~ 
9,~d$p:d"p:3&+L3F2( 3B+M 
9,~,iPS<
9,~d$p:d"p:2f+X3F3h 3B+Z 
9,~,+]i<x :   
"fbBgng3B+c +c 
93B+e ,~ +J|~ 0 j+hh,+mz<. >   
"wbBwnx3B+s +t 
93B+v ,~ +J|~ 0 {+x,+~&<VL@   
"bBn3B+ + 
93B+ ,~ +J|~,+<	"`   
"bBn3B+ + 
93B+ ,~ +J|~  +,+V<V> Bxd"p:B B B 
"(bB(n)3B+# +# 
93B+% +' >~+J>~,~|~,+,V<W> Bx,k3 B x:d D@@ d"pl"0>,~,>59<w4"7 ,~ 
9,~ :+S8,>=A<
4B? ,~ 
9,~ B+jR@,>EJ<W1B+G ,~ 
9,~ 0 K+jRH<X<@,> Q,kJ Q x 
>+k<XK<X<@,> X,kJ W x 
>+k<YRChangeDefinition?%rfis notian editablenfunction>Bx@x@~,kB6v0V+e6v0V+g x w,j>,j?  ,k B~  ,kM w,kM2B+p ~  ,k +u 
,L2@   
   x, -4kP>,~<<`x|Illegal commandList emptyYou are already at the top level<a NOT FOUND<<@> Bx D F @| @{-4kN`,jG B}Z, L} 
}L~~,jG B~ }  D
,k  
,kB|6!	0V+ M6!	1V+ .0v+,>7@+!@@ ,jg3B+ 8 | ,k 
!2L+!  ,!++ $  
,k~+J+!,k#+ $  D
1V+ P0v+ S6@|+ x ~  B
|2L!+ Y 
,k+ $ 
|2L!+ \ } +! 
|3L!+ q 
|2L!+ `,kR+ $ 
|3L!
|2L! 
,k B}+ $ !
 |,k3B+ i,kS+ $ 
|2L!
+ o  
,k,js  
,k+ $ 
|2L
9+!+   ~2@8+ t !,k#+ $ ~  B~  D~  F
|L{|,jy !,k#+ $@@ {,jg3B+! |  D
| L~ ~ ~,j< B~+ $ !
,k#+ $-4kP>{,~<<<|   <" <b<#<!<c<c<( <)> Bx D6!1V+! +!Z$,jg3B+! x,k  +! >,~<***> Bx D6!*0V+!) ,jh3B+!" !++!) ,k  x ,! B  x ,! >~+j|>~,~<!> Bx D F6!;1V+!0 +!:  ,jT3B+!5  
L+!8x,!+xx+!,>~,~<>BxDsFp@~6!L1V+!@+!K,k3B+!D>~+j<,j<8x,!;2B+!Kx+!<>~,~<Listempty,>,>6!`1V+!S!a,k#+!>0H+!Y,kB8 B
~3,+"~""0B+"xx~8d"pQ"`,"K+" ~ ,kX  D~3D+"  ~,"K>~+">}+kO<8	%p%n%p -> %p:%n	%r%n<h<@> @x @ 
3,|+"G 
6"H0V+"78d"p3bY+"7Z",kZ,,kX  D3D+"D  8d"p,k[   "I,kW+"F   "I,kW>+"->~+kO<0<8" "!"#"%<h,>,> 
***** Fatal error:%s,>  "],kB,k\+"\"WIndex %r out of range for %p in %p   "e,j>+j?"^ Z"1+k]<a<@<'"l<,"m?%l (Y or N) <l<@<m<@> Bx @-4kN] ,k^ B} 
,j>QB #	,k  D~2D+# #	 ,k2B+# 
2L#+#   #,k` 

9 L+"v ~,k_ },k^ 
#L-4kP>},~<p"g<!"h"i"j%p***** Continuable error, retry form is:***** Continuable error: retry form is %r***** Continuable error.***** %l,>,>-4kNp-4kNq 

9 L D3@+#/3@+#/  ,j~3B+#/  #5,kB2@+#' #5,kB+#. ,keZ$,j~3B+#+  #4+#- #4,kB  #3,kB,kR+#0  x,k]-4kP-4kP>,~#
####An attempt was made to do %p on %r, which is not %w   #?,j>+j?#6An attempt was made to use %r as %w in %p, where %w is needed,> 
  x  #K,j>>+j?#?an integeran index #R #Q+ke#L#Na pair #U+j3#Ran identifier #Y+j3#Va number #]+j3#Zan integer #a+j3#]
a non-negative integer #f+j3#aa character #j+j3#fa string #m+j3#ja vector #q+j3#na words vector #u+j3#qa sequence #y+j3#u	a legal I/O channel #}+j3#y***** %l,>,>-4kNq D3@+$	 $,kB3@+$	  ,j~3B+$	,kR+$
3@+$
,kX x $,kh-4kP>,~<x#~<r<@<{$<x<@> Bx 2@8+$ 
9+$ln eyxD$#,jm  $" $",jf  $! $!,jf >+jm<~$<y$<V> Bx-4kNwr $.,kj B2@	+$, x,js,jG B ,kk -4kP>~,~<xChannel not open $3+kl$/
Channeloopen fornread%only $>+kl$9Illegaltocloseostandardrchannelc$D+kl$>I/O Error: %s  $I,j>+j?$D
d,` Z06$]0V+0 8 R@ 8:1PC0|1p|
+$W $^+j?<$PToo many arguments to function,>,>$w6$w0V+$l 
x3,$x+$v  ,>,js,^,^>,>,>+$d,^+$t,^|
,^|
,^|	,^|	,^|,^|,^|,^|,^|,^|,^,^,^,^,^,^d,`+0 $x+j?<x$^,>%@@ 6%0V+%  ,>,>,js,^,^,^6%0V+%: 
 ,>,>,>+${(HQ/O@,~>6%1V+% 4F%,^,^,>,>,kp,^,^=%
 ,~<<Internal error in function calling mechanism; consult a wizard 
/,iqd,pl,@,>Z
 
1+06%30V+%2 0 
06%30V+% 82P%4+% 8 8 
8 8Z0 l,>6%30V+%..222l+kq 8ZTO Q
 VH @ VQ
 8:1P 0|+%% Rl ,ju*x,kr,^>,~ %4+j?<<%<Illegal functional form %r in Apply.%Cd,`1N+1iq1N+00N+%A 02N%D+%A ,>+%" %C ,j>+j?<%5<~Undefined function %r called from compiled code>,>,>,>,>,>,>,>|,>|,>|,>|,>|,>|,>|	,>|	,>|
,>|
/4iqQ4`  %_,j> @@ ,jg,^|
,^|
,^|	,^|	,^|,^|,^|,^|,^|,^|,^,^,^,^,^,~%DArgument number mismatchIll-formed function expression> Bx D6%|0V+%k 
%~3L+%n,j<  %~Z"'>~+jg @ @~  ,kp B2B%}+%v  x,j<  %}Z"Y>~+jg x  ,ju B~7@+%{ ,ks ~>~,~<%`%c<~Argument number mismatchIll-formed function expression> Bx D6&J0V+&
 
&M3L+& @ @~ @~ D6&J1V+& +&  B},jf,jG  F~ F~   B6&J1V+& ~+&  B},jf,jG ~ B8 ~  D~+& x,j|  &MZ"(>{+jg @ @~ @~   F@@~6&K0V+&,6&K0V+&,    ,kp   B   D:~+&"6&K1V+&/6&K0V+&D @} @} @| 
iL}6&L1V+&4t+&@}B|,jf,jGB|&B}}kB}6&J1V+&;'}+&@B|,jf,jG | B8 |  D|+&7 x,j|  &LZ"Z>{+jg x  ,ju B~7@~+&H ~,ks ~>{,~<<<<<}%&<~Ill-formed function expression
 L}6'1V+&b +&o }  B|,jf,jG  D| D} }  B}6'1V+&j }+&o  B|,jf,jG | B8 |  D|+&f x,j|  ~Z"u+' xd$pd$pl$@ D x,ku3B+&y x,ku ,ko+&| ' x,kv ,& B~+'6'0V+&>{+ko6'0V+' 
'2L+'>{+&t@@~@~D6'1V+''+''B},jf,jGF~F~''B6'1V+''~+''jB},jf,jG~ B8 ~  D~+' x,j|  'Z"'>{+jg>{,~<<}<&N<~<&RIll-formed expression in Eval %rUnknown function type %r
>}+jg @ @~ @~ ,kw B d$pd$pl$@ D~2B+'D ,ku3B+'A ,ku x ,ko+'T 'g ,kv x ,%g+'T2B'f+'H  x d$p,iq+'T2B'f+'M x ,jk d$p,iq+'T2B'e+'Q  xd$p,iq,''+'T  'e,j> x Z"
,jg B~+'b6'c0V+'Y  >}+ko6'c0V+'^ 
'd2L+'^  >}+%g  'd,j> x Z">}+jg>},~<<'<~' <<<<'#<<@<*'h<z'k<'h>     Dx '  ',jf  '~,jm '~  '},jf  '} '|,jf B x ,j< '|,j|  >+jm<y<~'h<'i<z<'j<<@<z(((<(<z(<<@>     Dx (  (,jf  ( (,jf B x ,j< (,j|  >+jm<y<~(<(<{(<<@<z(<(<(<	<@<<@<	<@((<( (!<@("<@<*(<
(#<	(>     Bx (6,j< (5  (5 (4,jn (4,j<  (3 (4,jf B x (3 (2,jf  >+jm<y(((<~((<>   Dx,js,kj B2@	+(> x,ju B ,kk >~,~  (A+j<<y+kh x +(L	Catch stack overflowCatch-throw stack overflow (warning)> Bx D F 
_* L~Z..N_*@@.(_2h_*+(Y2H_*+(U  (aZ"1,jg@@."_)2b_*+(Y 
(a L,k} _* 
x L8 _* 
 L 
 L,k} _* B  D	 ~>~,~(E(H B_*  B	,~@@."Y	 B_*,~> Bx D 
_* 
0 L3@+(o 
3L(y+(o3B+(o"..N_*+(h @~ @~ _* 
  L~ 
  L~  ,kr"..N_* 

9 L	 
x L ~ ~ >}+(z<	  Dx,~ _*+)
Error notwithinErrorSetCatch+tagG%rxnotfoundin Throw>+Bx D@@.(Y	2F+)3B)+)  ),j> B x,jf B~,jf+ ~),jf+ Z"1>~+jg )>~+k/3@+)2B+)>~+k{/&+)(}<w)<x>-4kN
6)L1V+)6 +)8   B+)1 
96)J1V+): 3B+)F )L,kj B2@	+)A  ,js B~ ,kk ~ B2@	+)1  B   D+)1 x,ks -4kP-4kP>~,~<<<<0<GO attempted outside the scope of a PROG%r is not a label within the current scope> Bx @3@+)f  ,k B2B+)c x  )k,j> B x )j,j<  Z"\>~+jg B  )j>~+k| )j,j|  )iZ"
>~+jg)M<<)RRETURN attempted outside the scope of a PROG3@+)t  D  )y+k|,jf  )y,jm  )xZ"
+jg)k<<"",~Continued< ),~)|Z",j9 :l"O@S&H d"pl"@,~ 
C$iqZ [1B+* +*
 
93B+*[/1Bap+* +* 
93B+*Z// 5b* +* 
93B+* 
91( +* 3B+* Q"`,~Dumplisp requires a filename argument,>6*)1V+*" **,j?,k4 Y Y,kC ! !,kC |ZG*F.",kC x>+*=<*> B D .&(F{ Fx /((H{ 
2&+*4 / >~+*5 >~,~S&XS$XO@,~Couldn't GTJFN `%w' for Dumplisp 
 d$pl$`S"+*DQ"Z$0l$Z&A@@,~ *F ,j>+j?*9Couldn't open binary file for input> Bx -o -p,l B5B*T x,jf  *V,jm  *UZ"1>+jg>,~*G<Couldn't open binary file for output> Bx -p -q,l B5B*d x,jf  *e,jm  *eZ"1>+jg>,~*V<2@$+*id"p."
,~Z, L$,laZ"+lB@2@$+*o."|,~Z,@L$@.$kZ"+l2@$+*ud"p."iq,~Z, L$,l Z"+l
 x ,$,j> Bx x,jf  ,$,jm  xZ"1,jg   B~@@,k5 By ~:,k5 B~@@x 
x2l~++    B_+Z$ _+."& @@.$_+ Q$I"`C"_+d"pl"@,l	 x.~d"p B:x++   B} 
_* L},k2 B_*@@,k2 By   ._* D| } _* Q$I"`   B,k5 B|   Q$I"` 	+ >}@@x 
x2l}+, x |d, " B{ x._* Dz1B++=1B++X1B++y+,&,! F{(,! Hz 0"0b++C++A@+D@+T@+F@+O+, 
.
_* J+,1(k++HC.\.Nz++M1(++L 
.
~C(
./x Hz++MC.
.Nz 
z L+,1(++R 
.
~ 
/x Lz 
z.*iq J+,1(++W 
.
~ 
/x Lz 
z L+,&," F{(," Hz 0"0b++_++]@+_@+s@+c@+m+, 
.
_*  
l,# N+,1(k++eC.\.Nz++j1(++i 
.
~C(
./x Hz++jC.
.Nz  
zl,# N+,1(++p 
.
~ 
/x Lz 
z.*iq  
l,# N+,1(++v 
.
~ 
/x Lz  
zl,# N+,&," F{(," Hz 0"0b++++}@,@,@,@,
.
_*  
l,# N+,1(k+,C.\.Nz+,1(+,
 
.
~C(
./x Hz+,C.
.Nz  
zl,# N+,1(+, 
.
~ 
/x Lz 
z.*iq  
l,# N+,1(+, 
.
~ 
/x Lz  
zl,# N:x++4 y |,k5 |, 
} L_* y |,k4 >x,~DD @Hx<*x._*d&pl&p+jn ,jf  ,*+jm<Y,>,>6,31V+,/ +,2  ,l
xB+,,>,~<,jfln,7+jm<,>,>6,A1V+,;+,@  
*** %w already loaded> Bx @ @ @~ @~-4kN3@)+,S 

9,L-3+,Y3@)+,X x -,kB+- +- 
9-4kN 
( L 
9-4kN3@+,_3@~+,` +,o 
)xL3@+,m2@~+,mB~x   -,j> B~,k'3B+,k    D~   D+,a   B+,]-4kP2@~+,s x -,j>,j?+- 
,k2@.+,} +- .  B~ .  D.,,L+,{-4kP-4kP>},~,B,D,G,I> Bx3@-+- @ B6-1V+-
x+-.Bk2B+- ,jG  .,jI B.   B+-	>~+kJ>~,~<< <@,> -,kJ - x 
>+k< -< <@,> -&,kJ -% x 
>+k< - <!<@,> -,,kJ -, x 
>+k<!-&<!<@,> -3,kJ -2 x 
>+k<!--<"<@,> -9,kJ -9 x 
>+k<"-3<a<@,> -@,kJ -? x 
>+k<a-:<"<@ -E,kJ -D 
+k<"-@<"<@,> -K,kJ -K x 
>+k<#-E<#<@ -P,kJ -P 
+k<$-L<$<@> Bx D F -Y,kJ -Y   x 
>~+k<%-Q<$<@,> -`,kJ -_ x 
>+k<%-Z<&<@ -e,kJ -d 
+k<&-`<&<@ -j,kJ -i 
+k<'-e<&<@ -o,kJ -n 
+k<&-jHH`ChannelReadChar> Bx B4"-w1b+-x .,kg  cO B4B-| @@8cO+-  c >~d$p+iq>~,~-q ;+lChannelWriteChar,>,>4".1b+. .,kg 
x0L+.
 @@8c_ 
:0co+. 
x0L+.  c_."A.  B8c_+. 
x0L+. @@8co @@8c_+. 
:0cc/xd&p,iq>,~|.pImproperly set-up special IO open call> Bx D @2D.J+./,l B@@cO 
.I Lc/+.D2D.I+.4,l B@@c_Z,( Lc 
.H Lc+.D2D.H+.C6.E0V+.B6.F0V+.B6.F0V+.B,l  B@@c_Z,( Lc@@cO ?d$p Dc ?d&p Fc/ @d(p Hc?+.D .G+.C .G,kn >~,~<?<?<@.".$<1<|<1<|<2Close,>,>4".O1b+.P .Z,kg  c? d$p,iq x,l$  
.Y L8c  
.Y L8c/  
.Y L8c? x>,~<{.JChannel not open for input in RDS> Bx3@C+.c C  ; 
,k 
; L2@x+.f 
C Lx 
x 
0c L 
3L.p+.k 
2L.p+.m .o x>~+kl 
x L; >~,~.Z<|<{Channel not open for output in WRS> Bx3@D+.z D  
,k 
 L2@x+.} 
D Lx 
x 
0c/ L 
3L/+/ 
2L/+/ / x>~+kl 
xL>~,~.q<|<{Z$,k$D,~ 
cL3D+/6/1V+/0v+/4$/Dc+//,j>,j?>~,~</Z$,k$,,~-kN;= 
N LM 
/D LK,l--4kP>,~<?,l0 ;+l/Unexpected EOF while reading on channel %r,>,>3@O+/S-4kN@  /T,j>,j?-4kP+/S P>,~/G,l-+jf> Bx D @~ @~-4kN@ 

9 LO,l- B L0N+/b2B/}+/`,0
+/{2B/}+/b +/{,jG  D~ D~ x,l- B L0N+/w2B/}+/i ~+/{2B/}+/w x,l- B L0N+/p3B/}+/o2B/}+/p,0
+/{ ~ B8 x,l- B L0N+/v2B/}+/v ~+/{,0
+/{,jG ~ B8 ~  D~+/d-4kP>},~<<*** Unmatched right parenthesis,>3@O+0 +03BC+0 0	,kB x>+l->,~/~Dot context error 0
> Bx-4kN@ 

9 LO ,jG  D~ D x,l- B L 
90D+0 2B+0 
9 
2L0$+0 3B+0  ,jG ~ B8 ~  D~+0  ,j=-4kP>~,~<.***** READ Buffer overflow, Truncating d ,l Bd  d!C"_+l" df Md$p.F 
 Ld  d!0.D+03:d! d!,~ d!0ND+05 07,kBZ"D Bd!,~0$@@L d!0N+0=@@C"_+l" d"Q"`,~@@ d!C"_+l" df d!> B_+3@S+0DC"_+,k6+l5C"_+d"pl"@+l	Z, LL@@ d!C"_+l" df d!> B_+C"_++k6 
 @@ d!C"_+l" df d!> B_+  C"_++3 
 Z, LL@@ d!C"_+l" df d!> B_+  C"_+d"pl"@+l6> Bx D @Z$C"d&d D@@@@C"d$d D@@@@C"d'd D@@ d!> B~@@~ 
~2l~+0w ~C"_+l" d",l6 C"d%d D@@C&d&C$d$C"d$FC&d%C$d$C"d$:~+0i7`x+0 @~Z, L~ 
~2lx+1C&d&C$d$C"d$F:~+0y6 x+1"x Bx @~Z, L~ 
~2lx+1C&d&C$d$C"d$h:~+13@+1
C&d$C$d'C"d$(Z, LL,k3 BC$d$: d"pl"0>},~
MissingoexponentiinifloatDigitnoutnofrrangeRadixgoutofrangeg continued over end-of-lineIllegal to follow package indicator with non IDUnknown token typeInternal error - consult a wizard,> Bd @@d!@@d! x,l Bd Md&p.B 
 Ld  d 1N+15  d!C"_+l" df:d! d 4"1@1b+1I0"0b
+1H+1=@1J@1Q@3l@1T@1V@1X@1Y@1]@1^@1@1a@1h+1iZ, Ld"+2n3@I+1l1&0+20f=+2/& d!>C"+l" df+2Z, LL Q"`+3q Q$` d >+4D2@I+2+1k>d!+2'@@d!Z, Ld! 3w,l72@I+2+1| 3v,4B+1kO@d"+2?Z, Ld"+2?@@d!,0) d 1.+1g d x,l 3v d >+4DZ, Ld"+3;>d!+26 3u>+4B>d!,0),0) d 1n+1l d 1N	+1l d 1N	+1l d 1N+1k d 0N+1w>d!Z, Ld!,07,l7@@d!+1| d x,l>d!7@d!+1{ V,l7>+07,0) d 1N+1l d 1N+1k 3u,4B>d!,0),0) d 1.+2 d 1N	+2 d 1N	+2 d 0N+2 d1.0+2 d0n=+2 d/& d!>C"+l" df+2 d 1N+2 d 0N+2>d!Z, Ld!,07,l7@@d!+2 d x,l>d!7@d!+2 V,l7>+07,0) d 0N+2% d1.0+2 d0n=+2 d/& d!>C"+l" df+2 d 1N+2 3u,4B,0) d 0N+2/>d!,0) d 1N+2' d x,l>d!>+0F d0N+232@S+23 3t,kB+2' d0N
+29>d!>+07@d!0N+2<>d!,0)+26@d0N+l" dfZ, Ld!+3/ d 1N+2K d 1N	+2K d 0N	+2\@@d!6 d"+2MZ"+2NZ" @@C"+l" df dZ$C"+l" dfZ, Ld!3@I+1l1&0+20f=+2/& d!>C"+l" df+2 d 0N+2f@@d!6 d"+2`Z"+2`Z" @@C"+l" dfZ, Ld!3@I+1k+2 d 1n+2n d x,l6 d"+2kZ"+2kZ" Q$` x>+4D,0) d 1.+2n d0N+2y>d!Z$Z",0L Bd"@@d!1"+2v1b+2x 3s>+4B0b+3!+3 d1N+3/ d1N!+2~ d0N1+3>d! d"Z">+0T d1N"+3 d0N2+3@@d#+3J d 1N+3	 d 1N	+3	 d 0N	+33@I+1l d1.0+2 d0n=+2 d/& d!>C"+l" df+2 d 0N+33@I+1k+2 d x,l>d! d"Z">+0T,0) 
d"2ld +3 d 0.+3 3r>+4B d x,l>d! d" d">+0T,0) d 1.+3! d 0n+3 d1.0+3, d0n=+3,"..Nd d d!>C"_+l" df d"."2bd+3!+3>d!,0) d1N"+33 d0N2+34@@d#+3J d 1.+3; d x,l>d! d" 
94"39 @@>+0]Z, Ld#,0) d 0.+3A d#0.+3@:d#+3<>d!+3< d1N"+3J d1N2+3J d x,l>d! d" 
94"3H "d#>+0]>d!Z, Ld#@@d$ d ,l Bd Md&p.B 
 Ld  d 1.+3]0B+3SO@d#+3V1B+3V 3r>+4B d ,l Bd Md&p.B 
 Ld  d 1.+3] 3r>+4B 
d  Ld$ d ,l Bd Md&p.B 
 Ld  d 0.+3f d$$$.d  Dd$+3^  x,l d" 
94"3i>d#$d$/d#>+0]x,lBd0B+3o@@d!+150B ;+l-1"+3|0b+3|/",~/",~,3+j6> Bx D F @~ @~ ,4.  H}3H+4  }  x>|+4 xd$p Dx 
&4bF4n4 F~@@~@@} 
}2l~+4}4x:l"~d",l6~$.DB~:}+4x 
*4-bJ4-n
4. J~@@}@@} 
}2l~+4)} (B8 B}}x:l"d",l6G} B}:}+46~+4+"}+4,}>|,~x0"0b+44+40@47@48@4=@49@4=@4=@4=@4:1B+4;1B+4<+4=@@,~Z",~Z",~Z",~Z",~Z",~ ,~***** Error in token scanner: %s  4D,j>+j?4>> Bx D @~ @~Z, LL Md$p @ ,kv  F2F+4M +4V x,l Q"` B~,k  D~2D+4U ~d$p x,l +4V >},~,l0 ;+l9> BxO@+ x,l B1B+4c1B
.
c_3jc+4v7`c+4vZ$ x,k$   x>~d&p+iq> Bx D d(p 
 &5bF5n5	 F@@~ 
~2l+5~xd"p:l" d"x,k$:~+4>~,~xx,k$  & " x,5&  & "C"d)l" d"  x>}+k$6@+5$Z$ x>}+k$   x>}+5&> Bx D F4D52  &  x,5&  &  C"d)l" d"  x>~+k$>~,~5D55Z$+k$+l<> Bx D F4D5?"
(D(,56AC"d)l"d"x>~+k$>~,~x,k$   x,l< >~,~,>C"d-,l?C$d- x,l; >,~d$p:+l>> Bx D @~Z$,k$ d$p 
"5kbB5kn5l B@@~ 
~2l+5h ~ d"p:l" d" B~0B+5eZ$ x,k$ ~ x,k$:~+5]Z$ x,k$ >},~x> Bx D2@.+5qd$p JP>}+l; @ @~ d&p JPd$p D 
(6bH6n6 H~ @~@@~ 
~2l~+6 ~ :l" d" B1" +60b-+6Z..N  x,k$:~+5x >},~x#<Unbound:,>,> 6,l;  x,l@Z$ x>+k$6> Bx @~ d&p JPd$p D 
(6NbH6Nn6O H@@ :l" d" B~ 
Md*p.B (1N+6 Y x,k$2@.+61 ~ x,k$ @}Z, L} 
}2l+6L } :l" d" B~ Md&p.B 
 L~ 
~1l+6/ 
~1L	+6/ 
~1L	+6/ Y x,k$ ~ x,k$:}+6! 
~1, +65 
~0l-+65Z..N~ ~ x,k$ @}Z, L} 
}2l+6L } :l" d" B~ Md&p.B 
 L~ 
~1l+6F 
~1L	+6F 
~1L	+6F Y x,k$ 
~1, +6J 
~0l-+6JZ..N~ ~ x,k$:}+68 >},~x#<Unbound ,>,> 6W,l;  x,lAZ$ x>+k$6O#<Code > Bxd$p D 6i,l; 
 
7 L7 +6d 
0l+6dZ&  x,l<Z$ x,k$Z&  x,l<Z$ x,k$ >~,~6X#<Unknown ,>,> 6r,l;Z&  x,l<Z$ x>+k$6j c_:3$c+6w7`c+6wZ$+6xZ$+k$... .  ...> Bx D F67)1V+70v+73&b+7Z$>~+k$ @~:Z( 7- Z",4o67*1V+7	0v+7
7`c+7#    x,lEZ, L~   B67*0V+767*1V+70v+7 
~2lc+7 x,lC    x,lE:~   B+767*0V+7 7,+7#3@+7% 7, 7+ xZ",4o   x,lE+7% 7+ 7+ xZ",4oZ( 7- xZ",4o >~,~<b<c<6x<J6y6z<3... .  ...> Bx D F67^1V+750v+783&b+78Z$>~+k$ @~:Z( 7b Z",4o67_1V+7>0v+7?7`c+7X    x,lFZ, L~   B67_0V+7O67_1V+7H0v+7I 
~2lc+7O x,lC    x,lF:~   B+7D67_0V+7R 7a+7X3@+7Z 7a 7` xZ",4o   x,lF+7Z 7` 7` xZ",4oZ( 7b xZ",4o >~,~<b<c<7-<J7.7/<3...> Bx D F681V+7h0v+7k3&b+7kZ$>}+k$ @~ @~:Z(- 8 Z",4o d$p 
"8bB8	n8	 B~5"7vZ(. 8 xZ">}+4o@@~68
1V+7y0v+7z 
~2,c+8  d$p.~  x,lE:~ 
~2l~+8 x,lC+7v 8 8
 xZ",4oZ(. 8 xZ",4o >},~<bx<c<J7b<3...> Bx D F6811V+80v+83&b+8Z$>}+k$ @~ @~:Z(- 85 Z",4o d$p 
"82bB82n83 B~5"8Z(. 85 xZ">}+4o@@~6831V+8"0v+8$ 
~2,c+8+  d$p.~  x,lF:~ 
~2l~+8- x,lC+8  84 84 xZ",4oZ(. 85 xZ",4o >},~<bx<c<J8
<3#<EVector > Bx D F68N1V+8<0v+8>3&b+8>Z$+8L 8P,k3B+8G 8O ,lH 3D+8G 
   x  
,k+8M 8O x,l;Z& d$p x,l<Z$ x,k$ >~,~<b85<W<W#<EVector > Bx D F68i1V+8W0v+8Y3&b+8YZ$+8g 8k,k3B+8b 8j ,lH 3D+8b 
 
9  x  
,k+8h 8j x,l;Z& d$p x,l<Z$ x,k$ >~,~<b8P<W<W...#<Words:> Bx D @~ 9,l; d$p 
"9bB9n9
 B5"8xZ( 9 xZ">~+4o@@~69
1V+8{0v+8} 
~2,c+9 d(p.~   9 xZ",4o:~ 
~2l+94x,lC+8y9,4o >~,~x<c<J8k<M<38l...#<Halfwords:> Bx D @~ 95,l; d$p 
"91bB92n92 B5"9Z( 95 xZ">~+4o@@~6931V+9 0v+9! 
~2,c+9+ ~ d"p:l"@d"  94 xZ",4o:~ 
~2l+9- x,lC+9 94 93 xZ",4oZ( 95 xZ",4o >~,~x<c<J9<M<39...#<Bytes:> Bx D @~ 9[,l; d$p 
"9WbB9Xn9X B5"9CZ( 9[ xZ">~+4o@@~69Y1V+9F0v+9G 
~2,c+9Q ~ d"p:l" d"  9Z xZ",4o:~ 
~2l+9S x,lC+9C 9Z 9Y xZ",4oZ( 9[ xZ",4o >~,~x<c<J96<M<397@@+lE,>,>":0"0b+9g+9a@9k@:@:@:@9|@:@:
@:@:@:@:1B+:1B+9u1B+9n0B+:  : xZ",4o+:  : x d"p 
	JPd*p 
(":bB:n::,4o+:  : x d"p 
	JPd*p 
(":bB:n:.",4o+:  : x 
d*p 
(":bB:n::,4o+:  : xZ",4o+:  : xZ"
,4o+:  : xZ",4o+: x,lI+: x,lJ+: x,lJ+: x,lC+: x,lF+: x,lG+:  : xZ"
,4o#>,~<x<j<N<L<Q<J<P<O<M@R:P@:O@:U@:S@:V1B+:F1B+:91B+:20B+:X  :a xZ",4o+:Z  :a x d"p 
	JPd*p 
(":\bB:]n:].",4o+:Z  :` x d"p 
	JPd*p 
(":\bB:]n:].",4o+:Z  :` x 
d*p 
(":\bB:]n:].",4o+:Z  :_ xZ",4o+:Z  :_ xZ"
,4o+:Z  :^ xZ"
,4o+:Z x,lI+:Z x,lJ+:Z x,lJ+:Z x,lE+:Z x,lG+:Z x,lI+:Z  :^ xZ"
,4o>,~<x<j<N<L<Q<O<Q<P<M  
:Q"A`    :qN+:pO@3B+:n`9:l H0@@H,~ :r+kn@:d-4kNZ j,:v-4kP,~,>C"x,>,>,>,>|,>|,>|,>|,>|,>|,>|	,>|	,>|
,>|
,;>y,~Unknown character code for PrintF: %r> Bx @~ @~ jd&p 
$;QbD;Rn;R D@@ 
2l+;P  jd"p:l" d" B~1B+;,kZ+;O:  jd"p:l" d" B~1"0+;0b=+;/" B~1B+;K0"!0b#+;+:{@;'@;*@;,@;/@;20"&0b,+;'+:z@;4@;L@;7@;8@;>@;L@;A@;C@;F@;L@;L@;H@;;+;L x ,k%:x+;O x ,kZ:x+;OZ$ x ,l=:x+;O x ,js:x+;O,l(4b;OZ",kZ+;O x ,lL:x+;OZ",kZ+;OZ$ x ,l=:x+;OZ$ x ,l=:x+;O x ,k\:x+;O x ,lL:x+;O x ,l;:x+;O x ,k&:x+;O x ,lK:x+;OZ",kZ+;O ~Q$` ;S,j>,j?:+;
}>},~x:> Bx D F H~ J~ 
~~x,kW>},~Buffer overflow while constructing error message:
The truncated result was: _+1.C+;vZ,( L_+@@Z$(C"_+l" dfC"_+d"pl"@,k6  ;z j ;z,jn+j?:_+  _+C"_+l" df,~;b;g> Bx D F H~ J~@@c`O@_+ 
,L}Z, L+:C"+l" df 
}L>}+k6,>Z"0,kZ x,k\Z">+kZ,>3B+<6<1V+<>+lK x ,lK x  Bx6<1V+< +< 
92B+<3+< >,~<> Dx F H J~C,| L~C,| L}C,| L}C,| L|C,| L|C,| L{C,|	 L{C,|	 LzC,|
 Lz-4kNC,|
 L|
 
z L|	 
z L|	 
{ L| 
{ L| 
| L| 
| L| 
} L| 
} L| 
~ ~   x,kW-4kP>y,~ Q"`,jG l B8 Bl,~> Bx ,jG  Dl D@@ca xZ",k  >,~> Bx ,jG  Dl D@@ca xZ",k#  >,~:d1 d1,~@@d1@@ca Z",k d1,~@@d1@@ca Z",k# d1,~ 
 3@d2+<\+lO6<c1V+<_ 

9 Ld2Z",~ n   n  Fn +j4<n@@cQ  Bd2,~Poorly formed S-expression in COMPRESS <l+j?<f-4kN_-4kNC 

9+LS,lPZ",l/-4kP-4kP,~-4kN,lPZ",l/-4kP,~+l,> ,j4  x>+k$+;+lR ,k  B x  Dx+=  =9,j< B x  B~6=61V+=  =8,jm+=3 ,jf B~ @} @} @| ~  D}6=71V+=" +=1  B|  =8,jm,jG  F| F} }  B}6=61V+=+ }+=1  B|  =8,jm,jG | B8 |  D|+=' ~,j| =8,j| B~    =7>{+jn<<<v<z<u<M<f=:<f<@> Bx @ @~ @~ ,js B x  Bx6=R1V+=D >}+js   D~    F~6=R0V+=L =S ~ ,k3B+=N 
~ L+=@ ~ ,=S3B+=@ ~>}+js<<=9> Bx D6=i1V+=W +=h6=j0V+=b  
=j2L8+=b   ,j~2B+=b ,jY  x,jg2B+=b 
9+=h   x,jT3B+=f 
9+=h   x+=T>,~<<<g     +lY%r is not a known form for assignment> Bx D @6>1V+=y   >>~+jf > ,kv  F3F+> ,jG  x ,jI >~+j| > x ,kv  D3D+>   x 
>~+k x ,k  F3F+> 
>2L+>  x 
,k +=t  x >,jf  >,j>>~+j?<=n<h<<i<i<> Bx D @ B~6>/0V+>. ~  B~6>01V+>$2@+>" >1+>" >1  ~,j2+>,,l[ ,jt >0 ~,kv  ,k B3B+>,  ,js ~  B~+> >},~<~<<k<k<l*,j7  >6,jI+l	>2 ,jf 
9  >:+jf<j ,jf   >>+jf<j> Bx D6>\1V+>F  ,k3B+>E +>[ >}+jf @ @~ @~ D6>\1V+>K +>Y  B}  x,>>,jG  F~ F~   B6>\1V+>S ~+>Y  B}  x,>>,jG ~ B8 ~  D~+>O >]>}+j|>},~<<<z<]>^<l<@ >b  >a+jf<>]        +>|<l<@<{>k<>l<>m<<@>n<@<l>o>p>q>r<@<\>s>t<@<r>g>u<@<N>v<^>g>w<@Argument mismatch in SMacro expansion> Bx D F @~ ?3,jG ,j| B~ 
 L}6?/0V+? }  B} ~ ?3,j< B~ },>_ ~,j< B~ }  D}+? ~ ?2,j< B~ 2@8+?   ,>>+?' @} @} @| 
 L}6?/1V+? +?% }  B|  ,>>,jG  D| D} }  B}6?/1V+? }+?%  B|  ,>>,jG | B8 |  D|+? ?2,j| ?1,j|  ?1,jm ~,j< B~,k,jG ?0,j| x,j| ?0>{+j|<}<<>g<<z>h>i>j<> Bx ?E,jG B x  Dx3@x+?C x ,jf B x  ,jf   ?E,jf ,j< B x   Dx+?8 >~+k<n<  ?H+k<n
Unknown const form %r,> ?S  ,kv2B+?R x ?S,j>>+j?>,~?H<nZ"+?U> Bx @@@,jg3B+?e x ,jCZ$ B,j~3B+?a ,ji  x ,jD >+k9Z& x ,jD x,k+?V@@ ,jC,ji @@ ,jD>+l`%r is an illegal action in ForEach>   D}    F}   H~  Bx 
jJB2J@+?{2F@+?z@+@@+@3J@+?}2J@+@2F@+?@+@@+@2J@+@2F@+@@+@@@+@@,j>,j?@B~j},jG@,j<@,j|j@@<@!<s<@ @$,~@ @&<@<@'<@(<@<@<s<@> Bx   @9,jm @9,jm  @8,jm B @8 x  ,jI ,j| @7,j| ,j| @7>+j|<<s@$<@%<<@;<s<@> Bx @ @~  D6@[1V+@B +@X 2@+@H  @^,jm @^,jm  @],jm+@H ,jG  F~ F   B6@\1V+@N +@X2@+@T  @^,jm @^,jm  @],jm+@T ,jG ~ B8 ~  D~+@J @],j| ,j| @\>~+j|<<<<s<@:<@a<@<@b<@c<@<@<s<@> Bx @~     D|     F~        H 
 
( 
( 
( 
( J  A-,jf,jG B} ~  D~ |  A-,jf B| ~ 8 81N+@}  ~   A,,jf B| 
A, L} 
3LA++A A+ ,kv B,lg B~  A*,jm ~   ,jf  ~ A-,jf B  ,jf  ~ A-,jf },j< B} ~ A*,jm  A),jm B} ~,jG B~ ~ |,j< B{ | A),jm },jm  A(,jm B{ ~   | A(,jf  | A-,jf A',j< ,j| {,j| A',j|  },k {,j| A&>z+j|<<s@_<y<<w<<v<w<w<r@`<<w<6A50V+A4 d$p iq 
93Fd2+A5 ,~ A6+j2,~<<6A>0V+A< d$p iq 
93Fd3+A= ,~ A>+j2,~<<x6AJ0V+AI d$p iq 
92Fd2+AD 3B+AJ iq2Bd3+AH ,~ 
9,~ AK+j2,~<<6AQ0V+AP d&p 
d2 Liq ,~ AR+j2<<x6AX0V+AW d&p 
d3 Liq ,~ AY+j2<<y6Ab0V+Aa6Ab0V+A` d(pZ.E F!iq+Aa Ac+j2 ,~<<<y6Aj0V+Ai d$p iqd"`d"pl"p,~ Aj+j2<<6Ao0V+And"p 	+0,~ Ap+j2<<z6Av0V+Au d&p  B+0,~ Av+j2<<z> B D6B0V+A|6B1V+A} +B @x 
 d(p 
!+0 Lx2@x+B +B x2D8+B 
9+B 
x x  Fx2@x+B +B x 
2L8+B x 
( L8 
 L( 
9+B 
x x  Bx+B>~,~<< B+B<{> B~ D~6B60V+B6B61V+B +B5 @ @ @x d(p 
!+0 L2@+B  +B5   F6B70V+B%2D+B% +B5 
 Lx 
 
( J2@+B) +B5   B6B60V+B2 
~2L+B2  
x 
0 L8 x B8 +B5 
 Lx   D+B'>},~<<<> Bx D6BF1V+B= BG >~+j2 @ B6BF1V+B@ +BE   B~ ,lm   B+B>>~,~<<<|> Bx D6BU1V+BL BU>~+j2 @,lk B  ,k2B+BS  ,j<  x,lk >~,~<<|> Bx D6Bd1V+B[ Be >~+j2 @ B6Be1V+B_ +Bc   B~ ,ln   B+B\>~,~<<<},>,>6Bn1V+Bj Bo>+j2,lk  ,k  x>+lk<<}> Bx D F6C1V+Bu C>}+j26C1V+Bx C >}+j2 @~ @~,lk B~  ,k  D~2D+C  ,j< ~,j<  x,lk+C 
 L >},~<<<> Bx D6C0V+C6C1V+C
 +C @,kv  F3F+C x,lk  ,k  x,lk >~,~<<> Bx D B6C 1V+C +C   ,lo   B+C>~,~<> Bx D B6C*1V+C% +C)   ,C.   B+C">~,~<
*** %p %r cannot become %p> Bx D6CB1V+C2 +CA @ CC,kv B2B+C<  CC x,k x,lp3B+C;  x>~+jt +CA2B+C> +CA  x  CB>~+kB>~,~<C*< CE+C < CG+C.< CL,kv3BCL+CK ,~ 
9,~<< CN+C <G CP+C.<G CV,kv3BCU+CT ,~ 
9,~<G<,>,>6C_1V+CZ +C^  ,lt   B+CX>,~<,>,lr3B+Cd Ce x>+lo >,~<> Bx6C{1V+Cj +Cj 
93B+Cz x,kt3B+Cn +Co 
93B+Cz C| x,kv2B+Cs C| B x,li3B+Cw C{ x,kv+Cx x,ku >+j|>,~<<<{<{> Bx,k  D3D+D x,li D x,lo D x,lo >,~<<{*** Function %r has been redefinedIll-formed function expression in PutDDo you really want to redefine the system function %r?*** %r has not been defined, because it is flagged LOSE%r is not a legal function type<{D!<D"<D#<<@> Bx D F6E1V+D* E,j2+E E ,k2B+D7  E,j> B~ x,jf B~ ,jf B} ,jf  } ~ E,jn  ~Z"
,jg+E E x,ll3B+D< x E,kB +E @~ @~ @} @}-4kN] x,kt2B+DL3@-+DC 

9 L~3@,+DL E x,ll2B+DL x E,j>,kM2B+DK +D E x,lm6E0V+DQ  x,lj E x,lo+Dr6E0V+DX ,kt2B+DX ,k   x,D%+D3@+D\   x,l+D  B|6E1V+D_ +D` 
93B+Dd | 3BE+Dd +Dd 
93B+Di  E x,k x,lj+Dr x,jf B| ,jf B| ,jf  | | E,jn  EZ"(,jg+D 
3LE+Dv  E x,k+Dw E x,lo3@,+Dz E x,lm+D| E x,ln3@~+D~ x E,kB x-4kP>{,~<<D<{<{D<~<D<D<DD <} 
6E0V+E*d&pg4(E0h+Ee,~.,~,~<+***** Binding stack overflow, restarting... E 
 L
"..Nl+E)el,kr+k~"`(B.l+kr EF+j23B+E=2B
9+E> EF+j?Z..Nl 
l2,l+EA+kqd"p l B' 
	
 L  D	
 ,~<E3E7 +kp l 
Pal~+EL Nl+P..2.l+kq[0p.0|ZL?Z
 1
 R8 @ P1
9EI 
l P5nEU Ll+P3,l+lw7 RA
/,=ET6E`0V+E_ d&p$E`0D+E^ 
9,~ ,~ Ea+j2<<
<6Eh0V+Eg d$p d"pl"P B
,~ Eh+j2<<	%r is an unbound ID,>,>6Ey0V+Ew d&p 

 L$Ez0D+Ev  E{,j> x Z"1>+jg +Ex Ez>+j2>,~<<<EiT and NIL cannot be SET6F0V+F3B+F3B
9+F d(p D!
 ,~ F+j? F+j2<<E{The null string cannot be interned> @ @~ d$p D JPd"p Bx 
&F,bFF-nF- F~5&F F.>}+j?5FF@@:l" d"Q"`+F+,Fs  DC"|l"@d"@@,jg3B+F" C"|l"@d"Q"`+F+  C"|l"@df ~,k1 B~ x,k6 ~d"pl"@  B9JP Q"`>},~xFThe null string cannot be interned> @ @ @~d"p Bx 
$FRbDFRnFS D~5$F: FS>}+j?5DF>@@:l" d"Q"`+FQ,Fs  DC"|l"@d"@@,jg3B+FG C"|l"@d"Q"`+FQ,k3 B  C"|l"@df ~,k1 B~ xd$p,k6 ~d$pl$@ >}+FW>},~xF.,>,k3 x>+FW> D	JPQ"` Bx,lx  x,lk x,li x>,~>d"p Bx@@ 
$FobDFonFp 
1d+FdZ*@@2f+Fl  x:l" d"Z$/(BF :+FdZ$  >& ,~xOblist overflow> Bx,lx B B~O@ ~C"|l"@d"5BF| 
3LG+F{ +G ~+G ~C"|l"@d"2BG+G 
2LG+G 
~ L+G	 ~C"|l"@d" x 	JP,jS3B+G	 ~+G 
~0L +G@@+G
 ~: B~2B+Fv G,k/+Fv>~,~FpID or string6G0V+G+F
6G0V+G+F2 G G+j3<<Gnon-char,>,>6G11V+G! G2>+j2 d$p D0$@+G% G1 G2>+j3 
JP L ,Fs  DC"|l"@d"@@,jg3B+G/O@ C"|l"@df x>,~<G<,>6GM0V+G?d"p Bx1"@+G8 +G8 
92B+GL x 	JP,Fs C"|l"@d"2Bx+GL 
9+GL6GM0V+GL d$p 
"GNbBGNnGO4BGE +GF 
92B+GL x,Fs C"|l"@d"@@>+jg >,~<xZ",GRC"l,k6+l5 
 4bGa C"ll" d"  0$+G\ : C"ll" df,~Z& C"ll" df >+GR@@C"ll" d" :@@C"ll" dfZ"+GRZ",GRC"ld"pl"@+l	,>H,> 
1l?+Go@@+Gs x Q"` 
,k:+Gm@@ 
1l +Gv@@+H C"|l"@d"@@,jg3B+G C"|l"@d" xQ"` 
,k:+Gs>,~6H1V+HH+j8,Fs  DlC"|l"@d"@@,jg3B+H
> Bx @,l{ B5BH,k3 B  lC"|l"@df xd$p 
"H bBH!nH!,k1 B xd$p,k6 d$pl$@ >~+FW>~,~x> Bx,l{ B5BH&@@+H- lC"|l"@d" BO@ lC"|l"@df Q"`>,~> 	> BxZ,@ L 
2lx+H8  	JP,Fs  C"|l"@df:+H1 >,~Attempt to read from file failed d4HE4DH?1D+H? 3@,~,>,kZ,^,~
ad+HGZ"nH: d1D+HL,~Z$Z$,~Z" #lx $,~,HNO@l @@l 
CL;DnB read from terminal
Z" #dd$ :d"pl":d&pl& 
  Q$`)+Hd Z`/,~ He+knHU>,>,> 
l"HvbBHwnHw2bl+Hr@@l6Hx0V+Hnl" d" B:l>,~x<
No free channels left,>I x7@8d+I 
x1,+I I,kn:x+H|x>,~Hy@@d@@,~
,~I,H| O@d ,~> Bx,H| B IC IC x,I. B5BI I x>~+I7  B8d  
I L8c  
IL8c? >~,~<
<2> Bx,H| B ID ID x,I. B5BI' I- x>~+I7  B8d  
I- L8c/  
I,L8c?>~,~<  +I3 @@,~
`%s' cannot be open for %w> Bx D   IB,j> B ,jf  xd$pl$@ IB,jf  Z"1>~+jg<-I4`Exit to ErrorSetlisp breakBreak loop break> ,ji-4kNs-4kN ,k^ Bx ,k_ B 

9 L3@ +Ic 
I{3L +I[ 
  L! Iz  ,jI B! Iz,kj B2@	+Il 
Iy ! I{ " ",m B~ ,kk+Il 
Iy L! 
Ix L! Iz,kj B2@	+Il 
Iy ! I{ Ix Iw,m B~ ,kk x,k^ ,k_3@+Is-4kNrr Iw,j?-4kP+It ,js-4kP-4kP>~,~IE<`<IG<II<IK<,>,>6J0V+J J,kv  D3D+J  
>+k ! x 
,k B>,~<< 

9 L  J+kh< ,jf B+m"Can only continue from a continuable error; use Q (BreakQuit) to quit3@+J  B  J+kh J,k#+kOJ<<a<@ J ,kJ J+kU<aJ	ErrorForm!* : %r %n  J%+kWJ 
*** Editor not loaded J.,k3B+J- ,kM B,~ J.+kBJ%<\Exiting %w%nCpu time: %w ms, GC time: %w ms%nCpu time: %w ms%n<J:%w %w%w <J;<@<@> Jx-4kN  @~-4kN] 
K
 L* (:-4kN@@} 
 LZ$ (,k; B x,k#:( ,jG *,j< B*    ( K,j> B
9 K,k` B~3BK
+K6K0V+JI  B~3BK
+K3BP+K * 8 B83@++J\,m
 L3@+J^ ~,K
+Je  ,jf B} ~,jG,jf  } K
,jf  
9,k`B~6K0V+JI  B~3@++Jm,m
~ L83@)+Jz 
K
2L*+Jz3@,+Js3@~+Jz ",jf B} ~,jG,jf  } K
,jf  
9,k`3@++JI6@+J~ } K	,kW+JI  },jh   K	,kW+JI   K,kW-4kP -4kP-4kP>|,~<J/J1J5<<J7J8<,>6K0V+K K  ,ll3B+K x>+K 3@-+K - x 
,k+K x,l6K0V+K K x ,ll3B+K x>+K  >,~<<x<<> Bx  ,jf B x,jG,jf   K(,jf  
9>+k`<	No history entry %r,>-4kNr3"(+K0  K5,j>,j?+K3 (/ * ,k  -4kP>,~K),K+ ,~,K+    
+k,K+ ,~> Bx @ @ @~ (0.+KB +K\Z, L (> D6K]0V+KS 
K^2L+KKZ, L( ,jG B* +K\6 +KO "` * >~+Kb  ,j} B x  Dx6K^0V+KW x  ,j B (/ * ,k  /: >~+Kb>~,~<<x< 
%w	Inp: %p%n	Ans: %p%n,>,>5FKd +Kk>> ,Kb x     x    Kl>+kW>,~K_,kB+j6lisp N Ky-4kN=; 
) Kx Kx Kw Kw,m-4kP,~<`<!<Kn<?%f%p%n  K}+kWKy%w, %w> Bx D F 
( L~ 
* L~  H*@@(,l  x L,j> B) 

9 L, 
 L2 ,l  B2 
~ L( 
~ L* >},~K},>26L1V+L +L x ,js x  Bx+L  B2>,~<x%f%p%n<`<@Couldn't open file `%w'<{L <2<@> Bx @ @ @~ LI  LI,jf  ,k` B~6LE1V+L0 x LH,j> B} x,jf  LH,jm  }Z"1>}+jg  D ,k^ B  
9 LG,k` B~6LE0V+LB 
P3L+LB ,jf  LG,jm  
9,k`  D~6LF0V+LB2@+L3  LF,kW+L3 ,k^ ,l# >},~<<L<$L<#L<-L2@+LL+js+LL,>6L^0V+LR L` ,ll3B+LR x>+js3@-+LV - x 
,k+LW x,l6L_0V+L] L_ x ,ll3B+L] x>+js >,~<<x<<> Bx-4kN
 Ln,l,k^ B,kQ P B,jT2B+Lj ,js+Le ,k^,l# -4kP>~,~<23@@ Y Y+  Y BLq Lt 
O,m+Lr~l4 Lw Lw+kh<
>,lw,l~,m M,kj Bx2@	+L,m B x,kk 3BM+Lx >,~<
,m 
m`Lm+mMMM,kMMM,kMMM,kMMM,kMMMM,kMMMM,kMMMZ"M$<oM%<M&<M'<M(<M)<aM*<&<@<M,<M-<M.<M/<M0<<@<(M2<(M3<)M4<)<@M6M7M8<@pl:M:M;M<<M=<@.bM><$.lap@		
<*@		

<*
Portable Standard LISP	

 !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^`abcdefghijklmnopqrstuvwxyz{|}~NILID2INTNONIDERRORINT2IDTYPEERRORNONINTEGERERRORINT2SYSLISP2CHARNONCHARACTERERRORINT2CODESYS2INTGTFIXNID2STRINGSTRING2VECTORGTVECTNONSTRINGERRORVECTOR2STRINGGTSTRNONVECTORERRORLIST2STRINGLENGTHNONPAIRERRORSTRING2LISTCONSLIST2VECTORVECTOR2LISTGETVBLDMSGSTDERRORINDEXERRORPUTVUPBVEVECTORPEGETVEPUTVEUPBVINDXRANGEERRORNONSEQUENCEERRORSETINDXSUBSUBSEQGTWRDSGTHALFWORDSNCONSTCONCSETSUBSETSUBSEQCONCATAPPENDSIZECODEPEQFLOATPBIGPIDPPAIRPSTRINGPVECTORPCARCDRRPLACARPLACDFIXPDIGITLITEREQNLISPEQUALSTRINGEQUALEQSTREQUALCAAAARCAAARCAAADRCAADARCAADRCAADDRCADAARCADARCADADRCADDARCADDRCADDDRCDAAARCDAARCDAADRCDADARCDADRCDADDRCDDAARCDDARCDDADRCDDDARCDDDRCDDDDRCAARCADRCDARCDDRSAFECARSAFECDRATOMCONSTANTPNULLNUMBERPEXPTMKQUOTELIST3CONTINUABLEERRORGREATERPDIFFERENCEMINUSPTIMES2ADD1QUOTIENTPLUS2LISTEVLISQUOTEEXPRDELIST2LIST4PUTDFUNCTIONLAMBDAFEXPRDFMACRODMNEXPRDNSETQEVALSETPROG2PROGNEVPROGNANDEVANDOREVORCONDEVCONDNOTABSMINUSDIVIDEZEROPREMAINDERXCONSMAXROBUSTEXPANDMAX2LESSPMINMIN2PLUSTIMESMAPFASTAPPLYMAPCMAPCANNCONCMAPCONMAPCARMAPLISTASSOCSASSOCPAIRSUBLISDEFLISTPUTDELETEMEMBERMEMQREVERSESUBSTEXPANDCHANNELPRINTCHANNELPRIN1CHANNELTERPRIPRINTOUT*NEQNEGEQLEQEQCAREXPRPGETDMACROPFEXPRPNEXPRPCOPYDRECIPFIRSTSECONDTHIRDFOURTHRESTREVERSIPSUBSTIPDELETIPDELQDELDELQIPATSOCASSMEMRASSOCDELASCDELASCIPDELATQDELATQIPSUBLARPLACWLASTCARLASTPAIRCOPYNTHSUB1PNTHACONCLCONCMAP2MAPC2CHANNELPRIN2TCHANNELPRIN2PRIN2TCHANNELSPACESCHANNELWRITECHARSPACESCHANNELTABCHANNELPOSNTABFILEPPUTCSPACES2CHANNELSPACES2LIST2SETLIST2SETQADJOINADJOINQUNIONUNIONQXNXNQINTERSECTIONINTERSECTIONQKNOWN-FREE-SPACEGTHEAPFATALERROR%RECLAIMGC-TRAP-LEVELSET-GC-TRAP-LEVELDELHEAPGTCONSTSTRGTBPSGTEVECTGTFLTNGTIDRECLAIMDELBPSGTWARRAYDELWARRAYCOPYSTRINGTOFROMCOPYSTRINGCOPYWARRAYCOPYVECTORTOFROMCOPYVECTORCOPYWRDSTOFROMCOPYWRDSTOTALCOPYMKVECTMKEVECTORMKEVECTMKSTRINGNONPOSITIVEINTEGERERRORMAKE-BYTESMAKE-HALFWORDSMAKE-WORDSMAKE-VECTORSTRINGVECTORLIST5GCKNT*GCTIME**GCHEAP-WARN-LEVELERRORPRINTFTIMCUNMAP-SPACERETURNNILRETURNFIRSTARGLANDLORLXORLSHIFTLSHLNOTFIXFLOATONEPDEBUGTREVLOADTRSTQEDITFNS*EXPERT*VERBOSEEDITFEDITYESPPROMPTSTRING*FASTBINDTERPRIEDITORREADER*EDITORPRINTER*FASTUNBINDREADCLHELPBREAKEHELPPLUPOKDISPLAYHELPFILEEDITOR	IGNOREDINBACKTRACE*
INTERPRETERFUNCTIONS*INTERPBACKTRACEPRINTFBACKTRACERETURNADDRESSPADDR2IDVERBOSEBACKTRACEOPTIONS*WRITECHARCHANNELWRITEUNKNOWNITEM
CODE-ADDRESS-TO-SYMBOLPRIN1QUITERRORNOYESRDSERROUT*WRSERRORSETCURSYM**SEMICOL*ERRORFORM**CONTINUABLEERROREMSG**BREAK*EMSGPMAXBREAKLEVEL*BREAKLEVEL*FLATSIZEUSAGETYPEERRORNONNUMBERERRORNONWORDSNONIOCHANNELERROR*BACKTRACE*INNER*BACKTRACETHROW$ERROR$ERRSETCATCHCATCHSETUPTHROWSIGNAL*%UNCATCHCHANNELNOTOPENCHANNELERRORWRITEONLYCHANNELREADONLYCHANNEL
COMPILEDCALLINGINTERPRETEDBSTACKOVERFLOWRESTOREENVIRONMENT*LAMBDALINKUNDEFINEDFUNCTIONUNBINDNAPPLYFUNBOUNDPFCODEPGETFCODEPOINTERGETVALUECELLGETFNTYPE&&VALUE&&THROWTAG*CATCH-ALLUNWIND-ALL&&THROWN&&$UNWIND-PROTECT$&&TAG&&%THROWUNWIND-PROTECT*CATCH*THROWRESETCAPTUREENVIRONMENT%CLEAR-CATCH-STACKPROGBODY*PROGJUMPTABLE*PROGPBIND1$PROG$GORETURNSYSTEM_LIST*DATEDUMPLISPBINARYOPENREADDEC20OPENBINARYOPENWRITEVALUECELLLOCATION*WRITINGFASLFILENEWBITTABLEENTRY*FINDIDNUMBERMAKERELOCHALFWORDEXTRAREGLOCATION	FUNCTIONCELLLOCATIONFASLININTERNPUTENTRYLOADDIRECTORIES*LOADEXTENSIONS**VERBOSELOAD*PRINTLOADNAMESLOADLOAD1RELOADEVRELOAD*USERMODE*REDEFMSG*INSIDELOAD*LOWERPENDINGLOADS*IMPORTSPPPRETTYPRINTDEFSTRUCTSTEPMINIEMODEINVOKERCREFCREFONCOMPILERCOMPDFASLOUTBUGEXECMM	TERMINALINPUTHANDLERCOMPRESSREADCHARDEC20WRITECHARTOSTRINGWRITECHAREXPLODEWRITECHARFLATSIZEWRITECHAR$EOL$CHANNELREADCHARREADCHARIN*CHANNELUNREADCHARUNREADCHAROPEN
SYSTEMOPENFILEFORINPUTSYSTEMOPENFILEFOROUTPUT
SYSTEMOPENFILESPECIAL	SPECIALREADFUNCTION*
SPECIALWRITEFUNCTION*
SPECIALCLOSEFUNCTION*SPECIALOUTPUTINPUTCLOSE
SYSTEMMARKASCLOSEDCHANNELSPECIALRDSACTION*STDIN*SPECIALWRSACTION*STDOUT*CHANNELEJECTEJECTCHANNELLINELENGTHLINELENGTHPOSNCHANNELLPOSNLPOSNCHANNELREADCH*RAISEREADCHPRINCCHANNELPRINC
CURRENTREADMACROINDICATOR*
CHANNELREADTOKENWITHHOOKSCHANNELREADTOKENTOKTYPE*CURRENTSCANTABLE*CHANNELREADLISPSCANTABLE*LISPREADMACROMAKEINPUTAVAILABLE	*INSIDESTRUCTUREREADCHANNELREADEOF$EOF$
CHANNELREADRIGHTPARENCHANNELREADVECTOR*COMPRESSING*EOLINSTRINGOKNEWID
MAKESTRINGINTOLISPINTEGERDIGITTONUMBERPACKAGECURRENTPACKAGE*GLOBALRATOMREADLINECHANNELREADLINEOUTPUTBASE*IDESCAPECHAR*CHANNELWRITESTRINGWRITESTRING
CHANNELWRITESYSINTEGER
CHANNELWRITEBITSTRAUXWRITESYSINTEGERCHANNELWRITEFIXNUM	CHANNELWRITEINTEGER	CHANNELWRITESYSFLOATWRITEFLOATCHANNELWRITEFLOATCHANNELPRINTSTRINGCHANNELWRITEID	CHANNELWRITEUNBOUNDCHANNELPRINTID	CHANNELPRINTUNBOUNDCHANNELWRITECODEPOINTER
CHANNELWRITEBLANKOREOLCHANNELWRITEPAIRPRINLEVELPRINLENGTH
RECURSIVECHANNELPRIN2CHANNELPRINTPAIR
RECURSIVECHANNELPRIN1CHANNELWRITEVECTORCHANNELPRINTVECTOR	CHANNELWRITEEVECTOR
OBJECT-GET-HANDLER-QUIETLYCHANNELPRIN	CHANNELPRINTEVECTORCHANNELWRITEWORDS
CHANNELWRITEHALFWORDSCHANNELWRITEBYTESPRIN2FORMATFORPRINTF*PRIN2LERRPRINCHANNELPRINTFEXPLODEENDPOINTER*EXPLODEEXPLODE2FLATSIZE2COMPRESSERRORCOMPRESSLIST*	CLEARCOMPRESSCHANNELCOMPRESSIMPLODECHANNELTYICHANNELTYOTYITYOCOMMENTOUTCODECOMPILETIMEBOTHTIMESLOADTIMESTARTUPTIMECONTERROROTHERWISEDEFAULTCASERANGESETFEXPANDSETFSETF-EXPANDASSIGN-OPONOFF*MKFLAGVARSIMPFGONOFF#ARGDSDEFCONSTEVDEFCONSTCONSTSTRINGGENSYMSTRINGGENSYM*FOREACHCOLLECTJOINCONCINDOEXIT$LOOP$NEXTWHILEREPEATFORGENSYMMK*SQSIMPBINFLAMBDALINKPMAKEFUNBOUNDMAKEFLAMBDALINKMAKEFCODEPROPSETPROPFLAGPTYPEFLAGFLAG1REMFLAGREMFLAG1REMPROPREMPROPLUNBOUNDPVARTYPEFLUIDFLUID1FLUIDPGLOBAL1GLOBALPUNFLUIDUNFLUID1REMD*COMPUSERLOSECODE-NUMBER-OF-ARGUMENTSBSTACKUNDERFLOWCLEARBINDINGSMAKEUNBOUNDHASHFUNCTIONREMOBINTERNPINTERNGENSYMMAPOBLGLOBALLOOKUPGLOBALINSTALLGLOBALREMOVEINITOBLISTDEC20READCHAR*ECHOCLEARIODEC20CLOSECHANNEL*DEFNBREAKVALUE**QUITBREAKBREAKIN*BREAKOUT*TOPLOOPNAME*TOPLOOPEVAL*BREAKEVAL*BREAKNAME*TOPLOOPPRINT*TOPLOOPREAD*TOPLOOP$BREAK$BREAKEVALBREAKFUNCTIONBREAKQUITBREAKCONTINUEBREAKRETRYHELPBREAKBREAKERRMSGBREAKEDITTOPLOOPLEVEL*HISTORYCOUNT*LISPBANNER**OUTPUTSEMIC*HISTORYLIST**TIMETIME*NONIL$EXITTOPLOOP$DFPRINT*IGNOREINPREDOANSHISTCLEARSTANDARDLISPPRINTWITHFRESHLINESAVESYSTEMINITFORMS*EVALINITFORMSDSKINDSKINEVALLAPINMAIN.PRE-MAINMAININITCODEEOFCHARCONSTDEC20PDP10TOPS20KL10LISPDIPHTHONG@D.+ |8 %} '88'8<@lX%}Y<
L{~ l6d3<x$'~l<d><)<~
8lgdGY
Transfort v1.5, 19-Mar-86ourcMENed <'<|<|<(<|<
<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<|<(<)<)<*<|<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<{<}<}<}<}<}<

((''  0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ-4ks-4kq=M?;<?<@<@<@<@<@]<@w<@r<*<@<*<@
<@<@Z<@=N@<@<@<@<@<*] Z<@<*] <@<*] <@<*<@<@<*] <@Z<@d3ldCG0001(load doit)
PSL, On the DEC-20?!?" "psl.exe" (list (list 'off 'usermode
LtY	L}Ku^<@`sbcJe^Yg$*<@8<@<g'@&V<l$i<@8l<&y<@8<<`'P<@8Y<@<Ym'@aa,0<$q<@"<d,{rqLi<@8"<@<"r'@z<@wtLw*(l\|  )};*"<@<@lXzlU<@<@<@|{z 6` {w %t l<#<@#T:$<@<@	3	-Tnm<{<@{n~<{<@{C<@$i<@<y'@W<y$i @<y<
D|<y<
Bl<@<
<{<@<@<@<@1..ly<@<@<@*\l<@<@<@*gl	<@<@<@*pl<@<@<@*xl<@<@<@+l!<@<@<@+	l+<@<@<@+l4<@<@<@+l=<@<@<@+%lF<@<@<@+.lN<@<@<@+8lV<@<@<@+Cl^<@<@<@+Mlg<@<@<@+Wlo<@<@<@+`lw<@<@<@+hl~<@<@<@+rl<@<@<@+|ll4| Y Z [S8 h7
Hp@M9x]xI$831 _-P$a

P,"`@Or=(dPhb &OH/PQ^8
7 

[*06'p
mX
H	0
.( H	!3x	{PsL]hVq1X%hFUX	"p}Z8>p((,:XK	iIPm	vy`
%- t7	h4Xn%`r, HHx>(	v
	hy0>.H4HZMpB`@qx:8B"XqP"d(b+09hpxh,Q@oxb|Hyh

`*x/HBUh`{t6x7j@Kqxn7@Fy{!@A@^B8{0	E"x(h
:Cw(&'e,h C"G8
(=;29
 &601po5_HM
+=
7x0(p`m7 
lh6{xJYu$X
xTP4[x	hH"	yv`AHH\h@] H2SSs.|0 XRG5/ ;,(xC	(	gVXfh	.#`x3	ox#H%K }*`%	`
s6
,@aX*H
i)@I?89I8jnX`A=X@9.@Z
`	('B
b`
E0sP	r1
1r.@`#JPU:x)P
A;mY0Phk< 'pp0	o@*
>+

E	?H>P
}p8p
 0xP3S$p]9(l(IW@*Zh{mp!f 4hO

^(
^shF	?@3P50sTU<06`?10
	A0hC>Xi8_`[%@W5
96B`K
8#h{a{fy 4Y(	R?@
-}`
$8'
!40QRhZ&@
H8 p	x
*t0YFha0]	J\=15H	 #RXo#H$uA@93Xsth8H	Fo@	'PrA$(X6pVKXP@(`
!`@0A@}
O! >8PLX.]pX
3|H{
`
,'5T# KP$:0Y-@FH3p+8OGpmm
R[0h*PO+hAQU{H X
lxL`hX9`+) 	q2 <MrH
@
yEPGRcp`6PJ	aBH	&,XA<x?P
T	G+@#w@xM,=8{
`?ph(0lc	+xn1#.
(|.
#-<=0uP!PDgX0])98P/"h
=8
E+ 	@Pto$H,KP@uhE	 	lVH=`C	?yf(
xT$	H	=	p\c`3`uN@ci x	9 #
"8k@kx
h a58TMP9/`
c;hNpp0)V?`,Hf@
.[	U'HRp"0
i@) 
g1
>`E(x9 -(>axbw`]
 W

Xy@H)_PM,&(K8)8ZpW"Xh	$)(n
 ((DpQ[Ux$hF]X$(TNX'u(P )	
4`>4987/XU*X
k6(PZ0*&077 WFe*(YF0Z>
u=P	%#h
X1R8f<h(|8-
D@P\`
'P	hI0x8	`BH
R 1h	,	($ NPol
/?p608
O8R2 !h^N 
#0;]@	wH8	u?X\)xb;
\Q	kB(~%70x(p9P.}iP8	p
:hD8@X
C=R(4qX9 '@
ERJxcUf8
0Ht&Hh^Xkp	Wx)/p[HmH~
@L)Hj
pQRxz`
uh	&8
N'h+
+:pwH
pQ[@
/p(h,k/(L3} $`d%x/=hO`+@+}25%(ZbX
oM(v
[I8*`	`Z~X;Xu@,ZH^>h&w`0e-	mW
'`/`0
L518I5Pt0P_o Jn@
kxxH#8:P'H	SYH%)	
s`-< H@	}8FA \A0c_X[H20pB@dp	1HSh
(X<p	)@1P+`Thxy8+	r>H4 A
mV=@BJpjmnp
XP'82H`
{8*p[	CgH1p

5 cPVfHD 1pbH
x58Pn0{ ^~ h
X	5#P \-P
Pv
 h	B	)	P_<$hm`()d?(
ZPP&H
(x,:0	q
`o~ 	p|NZX8\X>H.H{	Pq tSpi\ E7P`n@ghd0@MV7(T8lrD
?t`uGwx,Prp,`lpY`%<p*	 8PRY
H+P65P	R0W X7	hY7/	h	S<H
fq^5<au=H?KxkiPw<@'X	PJXxf	nW8rxl7(9
(h_NP*	X'cB@Gj%@(G	h
>Y|0
`=QP5u0I (k	2X$.XwG0VW`	I	d4@	HE'@k D$p
v60_E	K`{@`	J(	hF 83	7&h
:U8|;8
	M70L. 0`;;8p5$3p2Pvp
x> {
wDx8j`(6@fP0P`2
x!hE?vhV|}hQ8s%H}xb .:h4	FrX-`@ig"s(01`F@4HL-x302p$h E-(16fw	
 pDtp@ohyX`'	~yP`N"0X uSN
-Dl	fz0IjXx>X!p
gh(g$0	x)= 0&6&dX& h
._hxH
BX^P&IV0q
8\#e)
vvHWzX}x	
""MH	9T(H
S"3(c8`	3+gP2WH!?h|

%CpF,qE`8CQ#
(( .<0
P_]
	Aps@x	*/xf,( xh0m8@	=U9p62O0vq7x:	0CP`'7h`A~Klwh8\h	X
I0*e(Y	p";V0&P\4;0e`+HSH8($.p
#V hzx
s	j0/8
&@Hy
b	s,8[XY0H0o 
7`p/(
ep:.(q4`9KrW=X
n8LHHx 
l]X5pZe|hp	Aaz@XS0s0XPs8hFu3P
ogH]PX+Hh
/	j	=({A8szx+8 7P	;zC(j:4(	<
BrhRups0	9K

1P	b28iP r(
O
tJ8eV(`
q]
xJ07!t
?(pO!^@vkhXH
Tjhh	f	VR ;P4	p8]8Xf_a#HH
|	8T=phY@88D	8M0	*%xy
Pv'F8>p(a(Q
B0noX'=1xI8U@
M@q"`X0!%`8uC@AH5X<@H@:>S9p
OBeP8xxxx=0
|(210qb8^q(]7Lx8fxz-hw:lc 'CV`c~4H{@h!	Bn|&	e
-XA`e:X	`0@y
$	0\ PSD@t	exG
wz:38kE7Hpd;p[x/`exm#(*:U8S^h	o
0x(HO8<hlXZ#xl@8ui:qhv
(7p7x%1P@x`4(BZJ0p
&&HDpOhx	z:-@
_@YP=
52-0)Ah 3XjP
;,0~Cu`id
LTA^xmDA (e
	@2hC P8;@`80c=p!HVdJN)PMjz h0{h# &`	zM<- x+`w r!`h
!,u <PE^0~htp K8j`O(vg	Z@+t(1p:xczeh	YEP-8Nd DXcn`A` 5-`84Q`axs	J(N4
u&
wx
-Yr5xk3X
Wpw x;|@k}@
O(x{X(S49.
		Xkr[@(+X(+(\hEu) mX^+E@Np/)1(eW*2CX@B)x
.8x@j "H 
'
e5P(2F8"R,`
d
ly(P8< $Z(
M}Px
p%X/>HX`LXp
(@
5bGH]X%fH`FwpX;s'h
FX	Uy}p *Hp}O<?X'x[N8+ ?#;
p@0B8k8 	H:@	HYw8Y88H	]	u/}(W(Z
h60(29P<H	b06XQ
DPSX)XhA	L+xloPx0@*p	L<XVP=TPO	6H&(	jc&x%T0	(dPS!(
6Zx:::::::::::::::::::	:	:
:
:::
:
::::::::::::::::::::::::::::::::::::: : :!:!:":":#:#:$:$:%:%:&:&:':':(:(:):)<*:*:+:+:,:,:-:-:.:.:/:/:0:0:1:1:2:2:3:3:4:4:5:5:6:6:7:7:8:8:9:9:::::;:;:<:<:=:=:>:>:?:?<@:@:A:A:B:B:C:C:D:D:E:E:F:F:G:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N:O:O:P:P:Q:Q:R:R:S:S:T:T:U:U:V:V:W:W:X:X:Y:Y:Z:Z:[:[:\:\:]:]:^:^:::`:`:a:a:b:b:c:c:d:d:e:e:f:f:g:g:h:h:i:i:j:j:k:k:l:l:m:m:n:n:o:o:p:p:q:q:r:r:s:s:t:t:u:u:v:v:w:w:x:x:y:y}:z:{:{:|:|:}:}:~:~::::::::::::::::::::bN:	:
:
:::
:
:bP:::::::::::::::::::::::::::::::::: : :!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.:.:/:/:0:0:1:1:2:2:3:3:4:4:5:5:6:6:7:7:8:8:9:9:::::;:;:<:<:=:=:>:>:?:?:@:@:A:A:B:B:C:C:D:D:E:E:F:F:G:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N	<@t:Q:Q:R:R:S:S:T:T:U:U:V:V:W:W:X:X:Y:Y<@<@<@:[:\:\~:]:^<@<@::`<@:a:a:b:b:c:c:d:dMM+:f:f:g:g:h:hZ:i:j:j:k:k:l:l:m:m:n:o:o:p<@<@<@<@<*:t:t:u:u:v<@<@:w:x:x:y:y<*:z:{:{:|:|:}:}:~:~::::::::::::::::<::::	:	:
:
:::
:
:@<@:::::
T2:::::::::::::::M9<@<@::::<*<@<*<@<@::::!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*<:+:+:,:-:-:.:.:/<@<@<@:1:1:2:2:3<@<@:5:6:6:7:7:8:8:9<*:::::;<?:<:<N:>N:?:?<@:@<
g:p:p:q:q:r:r:s:s:t:t:u:u:v:v:w:w:x:x:y:y:z:z:{:{:|:|:}:}:~:~::::::::::<@::::::::::	:	:
:
:::
<@:@<@<@<@Kn<<@<@<!<`::::::::::k<*<<@<@:<@:<@::::: : :!:!:"<@:#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.:.:/:/:0:0:1:1:2:2:3:3:4:4:5:5:6:6:7:7t:9:9:::::;:;:<:<:=:=:>:><@:?:@:@:A:A:B:B:C:C:D:D<@<@:F:F:G:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N:O:O:P:P:Q<@:R:R:S:S:T:T:U:U<@:V<*:W:X:X:Y:Y:Z:Z:[<@:\:\:]:]:^:^:::`:`:a:a:b:b:c:c:d:d:e<@:f:f:g:g:h:h:i:i:j:j:k:k:l:l:m:m:n:n:o:o:p:p:q<@<@<@<@<@<@<@<@:u:v:v:w:w:x:x:y:y:z:z:{:{:|:|:}:}:~:~:::::::::::::::::::::	:	:
:
:::
:
:@:::::::::::::::::::::::::::::::::::: : :!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.:.:/:/:0:0:1:1:2:2:3:3:4:4:5:5:6:6:7:7:8:8:9:9:::::;:;:<:<:=:=:>:>:?:?:@:@:A:A:B:B:C:C:D:D:E:E:F:F:G:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N:O:O:P:P:Q:Q:R:R:S:S:T:T:U:U:V:V:W:W:X:X:Y:Y:Z:Z:[:[:\:\:]:]:^:^:::`:`:a:a:b:b:c:c:d:d:e:e:f:f:g:g:h:h:i:i:j:j:k:k:l:l:m:m:n:n:o:o:p:p:q:q:r:r:s:s:t:t:u:u:v:v:w:w:x:x:y:y:z:z:{:{:|:|:}:}:~:~::::::::::::::<@:::<@::	:	:
<@:::
:
:
7U::::::::::::::
?::::::
?:::::::::::::: : :!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.:.:/:/:0:0:1:1:2:2:3:3:4:4:5:5:6:6:7:7:8:8:9:9:::::;:;:<:<:=:=:>:>:?:?:@:@:A:A:B:B:C:C:D:D:E:E:F:F:G:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N:O:O:P:P:Q:Q:R:R:S:S:T:T:U:U:V:V:W:W:X:X:Y:Y:Z:Z:[:[:\:\:]:]:^:^:_:_:`:`:a:a:b:b:c:c:d:d:e:e:f:f:g:g:h:h:i:i:j:j:k:k:l:l<@:m:n:n:o:o:p:p:q:q:r:r:s:s:t:t:u:u:v:v:w:w:x:x:y:y:z:z:{:{:|:|:}:}:~:~:::::::::::::::::::::	:	:
:
:::
:
::::::::::::::::::::::::::::::::::::: : :!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.:.:/:/:0:0:1:1:2:2:3:3:4:4:5:5:6:6:7:7:8:8:9:9:::::;:;:<:<:=:=:>:>:?:?:@:@:A:A:B:B:C:C:D:D:E:E:F:F:G:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N:O:O:P:P:Q:Q:R:R:S:S:T:T:U:U:V:V:W:W:X:X:Y:Y:Z:Z:[:[:\:\:]:]:^:^:::`<@<@:a:b:b:c:c:d:d:e:e:f:f:g:g:h:h:i:i:j:j:k:k:l:l:m:m:n:n:o:o:p:p:q:q:r:r:s:s:t:t:u:u:v:v:w:w:x:x:y:y:z:z:{:|:}:}:~:~:::::::::::::::::::::	:	:
:
:::
<@::I::::::<@:::::::::::::::::::::::::: : :!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.:.:/@:1:1:2:2:3:3:4:4:5:5:6:6:7:7:8:8:9:9:::::;:;:<:<:=:=:>:>:?:?:@:@:A:A:B:B:C:C:D:D:E:E:F:F<@:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N:O:O:P:P:Q:Q:R:R:S:S:T:T:U:U:V:V:W:W:X:X:Y:Y:Z:Z:[:[:\:\:]:]:^:^:::`:`:a:a:b:b:c:c:d:d:e:e:f:f:g:g:h:h:i:i:j:j:k:k:l:l:m:m:n:n:o:o:p:p:q:q:r:r:s:s:t:t:u:u:v:v:w:w:x:x:y:y:z:z:{:{:|:|:}:}:~:~:::::::::::::::::::::	:	:
:
:::
:
::::::::::::::::::::::::::::::::::::: : :!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.:.:/:/:0:0:1:1:2:2:3:3:4:4:5:5:6:6:7:7:8:8:9:9:::::;:;:<:<:=:=:>:>:?:?:@:@:A:A:B:B:C:C:D:D:E:E:F:F:G:G:H:H:I:I:J:J:K:K:L:L:M:M:N:N:O:O:P:P:Q:Q:R:R:S:S:T:T:U:U:V:V:W:W:X:X:Y:Y:Z:Z:[:[:\:\:]:]:^:^:::`:`:a:a:b:b:c:c:d:d:e:e:f:f:g:g:h:h:i:i:j:j:k:k:l:l:m:m:n:n:o:o:p:p:q:q:r:r:s:s:t:t:u:u:v:v:w:w:x:x:y:y:z:z:{:{:|:|:}:}:~:~:::	:	:	:	:	:	:	:	:	:	:	:	:	:	:	:	:	:	:		:		:	
:	
:	:	:	
:	
:	:	:	:	:	:	:	:	:	<@:	:	:	:	:	:	:	:	:	:	:	:	:	:	:	:	:	:	<@:	:	:	:	:	:	:	:		:		:	!:	!:	":	"4:	#:	$:	$:	%:	%:	&:	&:	':	':	(:	(:	):	):	+:	,:	,:	-:	-:	.:	.:	/:	/<@:	0<@:	1<@:	3:	3:	4<@<@:	6:	6:	7:	7:	8:	8<@:	9:	::	::	;:	;:	<:	<:	=:	=:	>:	>:	?:	?:	@:	@:	A:	A:	B:	B:	C:	C:	D:	D:	E:	E:	F<@:	G:	G:	H:	H:	I:	I:	J:	J:	K:	K:	L:	L:	M:	M:	N:	N:	O:	O:	P<@:	Q<@<@<@<@:	S*<*6<@:	V:	V:	W<@:	X:	Y
:
:
:
:
:
:
:
<@:
:
:
<@<@:
:
:
:
:
	):

<@<@:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
 :
 :
!:
!:
":
":
#:
#:
$:
$:
%:
%:
&:
&:
':
':
(:
(:
):
):
*:
*:
+:
+:
,:
,:
-:
-bR:
.:
/:
/:
0:
0:
1:
1:
2:
2:
3:
3:
4:
4:
5:
5:
6:
6:
7:
7:
8:
8:
9:
9:
::
::
;:
;:
<<@:
=:
=:
>:
>:
?:
?:
@:
@:
A:
A:
B:
B:
C:
C:
D:
D:
E:
E:
F:
F:
G:
G:
H:
H:
I:
I:
J:
J
d:
K:
L:
L:
M:
M:
N:
N<@<@:
P:
P:
Q:
Q:
R:
R:
S:
S:
T:
T:
U:
U:
V:
V:
W:
W:
X:
X:
Y:
Y:
Z:
Z:
[:
[:
\:
\:
]:
]:
^:
^:
_:
_:
`:
`:
a:
a:
b:
b:
c:
c:
d:
d
h<@:
f:
f:
g:
g:
h:
h:
i:
i:
j:
j:
k:
k:
l:
l:
m:
m:
n:
n:
o:
o:
p:
p:
q:
q:
r:
r:
s:
s:
t:
t:
u:
u:
v:
v:
w:
w:
x:
x:
y:
y:
z:
z:
{:
{>:
|:
}:
}:
~:
~:
<@:::::::::<@:::::<@<@::	:	<@:
::<@:
::::::::<@<@<@::::::::::::::::::::::::::::!:!:":":#:#:$:$:%:%:&:&:':':(:(:):):*:*:+:+:,:,:-:-:.<@:/:/:0:0:1:1:2<@<@:g:g:h:h:i:i:j:j:k:k:l:l:m:m:n:n:og<@:p:q:qf:r<@<@:t:t:u:u:v:v:w:w:x:x:y:y:z:z:{:{:|:|:}:}:~:~:::
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
<@<@<@<@<@:
:
<@<@<@<@:
<@<@<@<@:
:
<@:
:
:
:
:
:
:
SvSq:
:
:
:
:
:
<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@

<@<@<@<@<@<@<@<@<@<@<@<@<@ <@"<@$<@(<@<@<@*<@<@<@,<@<@<@02<@4<@6<@<@<@<@8<@<@:<@<<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@Q<@<@d<@<@<@k<@<@<@<@<@	-<@<@	2P<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@z]<@<@<@<@<@X<@<@<@T}5IA90h 
g	!
]
CY	)]Z2CXH		o<@<@<@<@\<@<@<@<@<@
W,<@A
i<@
<@|<@
<@j<@<@<@_*<@><@
C<@<@R<@U<@<@<@<@<@<@<@<@<@<@_<@<@<@,<@<@<@<@<@<@<@<@<@9J<@l<@<@a<@<@<@<@<@w(ZM<@<@<@<@_<@<@<@<@<@<@<@<@<@<@<@,<@<@<@`<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@*
9}<@<@'<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@N<@$wu
y<@<@<@<@<@:C\g<<@<@<@<@_<@$0CLJ<@|<@<@
&j<@<@<@V<@<@<@<@<@<@-x<@<@<@<@<@<@Ba6?<@<@<@<@<@UP<@<@"><@^<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@p<@<@<@8,<@<@<@<@m
m<@<@<@<@gW}<@<@A@<@<@<@
_D
"~<@F<@lpTI(<@d<@T<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@=<@<@G<@<@n<@<@<@
i!v<@<@<@R1E<@<@<@<@<@<@<@<@v<@<@<@	<@<@
<@	p<@<@q<@
<@<@<@<@A
A<@<@<@<@<@<@<@<@<@hF<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@f6<@<@<@<@<@<@<@<@<@<@<@<@<@2<@<@<@<@<@<@<@)<@<@<@<@<@<@<@2Th<@<@}<@<@
_<@*<@<@<@<@<@<@]+<@!e<@N<@
e<O
9Vn<@
x
<@<@<@<@<@<@<@<@<@<@4<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@Y<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@]<@<@
apm-.{3l<@<@<@<@<@<@<@<@<@<@;Ei{{S<@*<@r<@<@<@<@\z<@<@<@
<@<@<@<@<@<@<@@<@<@<@<@<@<@<@<@X<@x
4<@c<@p	<@UM
b oV
E$w:=O@<@<@3<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@
khKF<@<@<@a|
E<@<@<@<@<@<@<@<@<@<@.	G<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@P<@<@ O"o<@\.
w<@b-
<@9<@<@<@<@<@<@<@<@<@<@<@g<@<@<@<@<@<@<@<@KZ
(
owG9_<@Ti&<@
,j#,
}G%<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@#iP
G<@<@@	rh<@<@<@<@<@<@<@	!V
WgdH
]6d|Q
irY~W3C0^;]Z
{~W]u+@`K"n
M[	+s?

=<%
&)q%ft
3SEU
ct:
;Tn~.6Sy
#,
6Fy
Oi7=E
qF	
Ab
)tv8
2Kta4"ev5czlh<@<@y	v<
sbB8c
%
s	4>V^f
I	>.e
K}7\xX
Ge&VO	@
u
}fx1dwBAAD<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@1<@<@(<@
H$oQ
a<@R<@	6L;	
$v*r
Y<@<@<@M<@p<@SCC/
LR	tD)<@<@<@/<@3	
'x	<@	<@<@<@zE<@
kku

<@'<@r r^<@<@<@<@<@<@<@<@

Ib<@<@<@<@<@<@<@v<@5k!lD#
o	x	>f<@	'(
llQ<@<@<@<@<@<@<@<@4<@<@<@<@<@<@<@<@<@<@<@<@-<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@mf<@<@<@<@<@<@<@<@<@
M<@<@<@<@<@<@
*dN<@VXPt<@<@C<@<@<@p	jfMDzWOR<@(#"
,hTYPLr>zJgyr
i<@7$U<@)/`<@|"JSa 
YLQ	<@	!\^9=Gv<@:
u<@<@nnK
0
oPL(
q(7E20/W<@<@<@<@<@TG'v4@<@<@<@<@<@<@<@<@<@<@<@<@<@<@I.
7<<@<@<@<@<@E<@*2<@<@<@<@k]<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@X<@<@<@<@<@<@<@<@<@<@<@<@<@<@7<@<@<@<@<@<@<@<@	~.b8<@<@4)<<@<@<@<@<@<1&Re0<@<@<@<@
5<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@u<@<@<@<@<@Z<@
c8<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<
-

\
OtT':>:5$h
,
S.h8j
,[b	Bd
S';=fUUt
@>	l
qWQ^oPF	|BI
Q+`
K#J4b00tE
QrxhR~fq#;+u2
w0
{VhM?M
U5jO
S.YF.r[H
?HY?/
t`64bpj
7InlVzI0^
=%
=d
(U	p@)
s#[	#q
?[B
}WK~

:n$
	'{>jJ	?yU	nL
/[
e	O8tYB
N-	OK=
yDH	1
.9L
f
	%j	M[lw	8BY*23m@ysCS<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@+<@e<@<@<@<@<@<@(<@<@<@<@<@\X:<@<@<@<@c<@<@4	:s<@6<@<@<@<@<@|<@<@<@<@<@<@<@cQ<@<@<@<@2<@<@<@<@<@<@<@<@<@<@<@<@<@%d<@<@<@<@<@<@<@y<@1<@
[<@Bs<@<@<@<@<@<@<@<@<@2<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@
[<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@z`Zu<@q=n<@<@<@D<@&<@
;<@<@%<@<@<@<@V{<@<@?<@<@<@<@.
1x]<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@&Q<@<@<@<@rM<@<@<@<@<@<@<@<@<@<@D<@<@<@%w<@<@<@<@<@'<@dR<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@j<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@G<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@}G<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@_Q<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<<@<@<@<@<@<@
m<@<@<@<@<@<@<@<@<@u<@<@<@<@<@0P<@<@<@><@<@<@+<@<@<@<@<@<@<@<@<@<@<@b-
U<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@W<@<@<@<@<@<@<@;
++<@<@<@<@<@<@<@<@$<@<@<@<@<@<@<@<@<@<@<@<@7<@<@<@<@|<@<@<@<@X<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@L<@<@<@
?<@I3<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@<@
A	h<@<@TK5<@A!<@<@6<@<@<@<@<@<@<@[
<@<@<@<@<@<@NDNENFNGNHNINJNKNLNMNNNONPNQNRNSNTNUNVNWNXNYNZN[N\N]N^N_N`NaNbNcNdNeNfNgNhNiNjNkNlNmNnNoNpNqNrNsNtNuNvNwNxNyNzN{N|N}N~NOOOOOOOOOO	O
OO
OOOOOOOOOOOOOOOOOOO O!O"O#O$O%O&O'O(O)O*O+O,O-O.O/O0O1O2O3O4O5O6O7O8O9O:O;O<O=O>O?O@OAOBOCODOEOFOHOJOKONOOOQOSOUOVOXOYO[O]OOaObOdOfOhOjOlOmOoOqOrOsOuOwOxOyOzO|O}OPPPPPPP
P
PPPPPPPPPPPPPP P!P"P$P%P&P(P)P*P,P.P/P1P2P4P5P7P8P:P;P=P>P@PAPCPDPFPGPIPJPLPMPOPPPRPSPUPVPWPXPYPZP\P]P^PPaPbPcPePgPiPkPlPnPoPpPrPsPtPvPwPxPyP{P|P}PQQQQQQQQQ	QQ
QQQQQQQQQQQQQQQQ!Q"Q$Q%Q&Q'Q(Q)Q+Q,Q-Q/Q0Q2Q3Q5Q6Q7Q9Q:Q;Q=Q>Q?QAQBQDQFQHQJQKQLQMQNQOQPQRQSQTQVQWQYQZQ\Q]QuQ`QbQcQdQfQgQhQiQkQlQmQnQpQqQsQtQvQwQyQzQ|Q}Q~QRRRRRRR	RR
SSSSSSSSSSSSSS!S"S#S$S%S(S)S,S/S1S3S4S6S8S:S<S=S@SCSESFSGSHSISJSLSMSNSPSQSSSVSWSYSZS\S^S`SbSdSeShSjSlSnSoSqSrStSvSxSzS|S~TTTTT	TT
TTTTTTTTTT!T"T$T%T'T(T*T,T.T0T2T3T5T7T8T:T<T?T@TBTCTETFTGTITKTLTMTOTQTSTVTXT[T]T_TbTeTfThTiTlTnTpTsTtTuTwTxTzT{T}TUUUUUUU	U
U
UUUUUUUUUUU U#U%U'U)U+U,U.U0U1U4U7U:U=U@UCUEUFUHUIUMUOUQUSUUUWUXU[U]U^U`UaUcUeUfUhUjUmUqUsUuUwUyU{U}VVVVV
VVVVVVVVV"V#V%V&V)V+V-V/V1V4V7V:V<V?VBVDVFVIVKVMVOVRVUVXVZV\V^VaVcVfViVkVnVqVsVvVxV{V~VWWWWW	WW
WWWWWWWWWWW W"W#W%W'W(W*W+W,W.W/W1W3W4W6W7W9W:W;W<W=W>W@WBWDWFWGWIWJWKWLWMWNWOWPWRWSWTWVWWWXWYW[W]W`WaWbWdWeWfWgWiWjWlWmWoWpWrWsWuWvWxWyW{W|W}WXXXXXX
X
XXXXXXXXXXX X"X$X&X(X)X+X-X/X1X3X5X7X8X:X;X=X?XAXCXDXFXHXJXLXNXOXQXSXTXUXWXYXZX\X]X^X_X`XaXcXfXhXjXlXmXoXpXrXsXtXvXwXxXzX{X}X~
	
	
	
	
	
	
	
	
	
	
	!
	"
	$
	%
	&
	(
	)
	*
	,
	-
	.
	/
	0
	1
	2
	4
	o
	q
	s
	u
	w
	y
	{
	~











	




























 

"

$

&

'

(

)

*
U
W
X
Z
]
_
a
d
f
h
j
m
p
r
u
w
z
|















 
"
%
(
)
+
-
/
0
1
2
5
6
7
9
:
<
>
@
A
B
C
D
F
I
K
M
O
P
S
T
W
X
Z
]
^
_
a
c
d
e
f
h
i
k
l
n
o
q
r
t
v
x
z
|
~




	









!
$
%
'
*
-
/
3
6
9
<
>
A
D
G
J
M
P
R
U
X
[
]
`
b
e
f
h
i
k
m
o
r
t
u
w
y
{
}




	

















 
"
#
%
&
(
)
+
,
-
/
1
3
4
6
8
:
;
<
>
@
A
C
D
F
H
I
K
M
O
P
Q
S
T
V
X
Z
\
^
`
a
b
d
e
g
i
j
l
m
o
r
s
u
v
x
z
|
~







	


















 
"
#
%
'
(
*
,
-
/
0
1
3
4
6
8
9
;
<
=
>
?
A
B
D
E
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d
e
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
v
w
x
y
z
{
|
}
~










/
/
/
/
/
/
/
/
/
/
/
/!
/"
/$
/%
/'
/(
/*
/,
/.
/0
/2
/4
/6
/8
/:
/<
/?
/A
/D
/F
/I
/K
/N
/P
/S
/U
/V
/X
/Z
/[
/]
/^
/a
/b
/d
/f
/i
/j
/l
/m
/n
/p
/q
/s
/u
/v
/w
/z
/}
/~
0
0
0
0
0
0
7a
7c
7d
7f
7g
7i
7j
7l
7n
7p
7q
7s
7t
7v
7x
7z
7|
7}
7
8
8
?"
?$
?%
?'
?)
?*
?+
@-
@0
@1
@2
@3
@5
@6
@V
@W
@Y
@Z
@\
@^
@_
@a
@b
@c
@e
@g
@h
@j
@k
@m
@o
@p
@r
@t
@u
@w
@y
@{
@|
@~
A
A
A
A
A
A
A	
A

A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A 
A!
A"
A#
A%
A&
A(
A)
A*
A+
A-
A.
A/
A1
A3
A4
A5
A6
A8
A9
A;
A<
A>
A@
AB
AD
AE
AG
AH
AI
AJ
AL
AN
AO
AQ
AR
AT
AU
AW
AX
AZ
A[
A\
A]
A^
A`
Aa
Ac
Ad
Ae
Ag
Ah
Aj
Al
An
Ap
As
Au
Aw
Ay
Az
A|
A}
A
B
B
B
B
IU
IV
IX
IY
I[
I\
I^
I_
J
J
J

J
J

J
J
J
J
J
J
J
J
J
J
J
J!
J"
J$
J%
J'
J(
J*
J+
J-
J.
J0
J1
J4
J7
J8
J:
J;
J=
J?
J@
JB
JC
JE
JF
JG
JI
JJ
JL
JM
JO
JP
JQ
JR
JS
JT
JU
JV
JW
JX
JY
J[
J]
J^
J_
J`
Jb
Jc
N5
N6
N8
N:
N<
N=
N?
NA
NB
ND
NE
NI
NL
NN
NQ
NT
NU
NX
NY
N[
N\
N]
N^
N_
Na
Nb
Nc
Nd
Nf
Ng
Nh
Nj
Nk
Nl
Nn
No
Np
Nr
Ns
Nu
Nw
Nx
Ny
N{
N}
N~
O
O
O
O
O
O
O	
O
O
O
O
O
O
O
O
O
O
O
O
O 
O!
O#
O%
O&
O(
O)
O+
O-
O/
O2
O4
O5
O7
O8
O:
O<
O=
O?
O@
OB
OD
OE
OG
OJ
OK
OM
OO
OQ
OS
OU
OV
OX
OZ
O[
O]
O^
O`
Oa
Oc
Oe
Of
Oh
Oi
Ok
Om
Oo
Oq
Os
Ot
Ov
Ow
Oy
Oz
O|
O}
O
P
P
P
P	
P

P

P
P
P
P
P
P
P
P
P
P
P
P
Tr
Tt
Tv
Tx
T{
T~
U
U
U
U
U

U
U

U
U
U
U
U
U
U
U
U 
U#
U%
U'
U*
U,
U.
U1
U3
Y
Y
Y
Y
Y
Y
Y
Y
Y
Y
Y
Y 
Y#
Y%
Y&
Y(
Y*
Y+
a;
a>
aA
aC
aE
aI
aM
b
b
b
b
b
b
b
b
b!
b$
b%
b'
b(
b*
b+
b-
b.
b0
b1
b3
b4
b6
b7
b9
b:
b<
b=
b?
b@
bB
bC
bE
bF
bH
bI
bK
bL
bN
bO
bQ
bR
bT
bU

bW
bX
bZ
b]
b^
ba
bc
be
bh
bj
bk
bm
bo
br
bv
bx
by
b{
b~
b
c
c
c
c
c

c

c
c
c
c
c
c
c
c
c 
c"
c%
c'
c*
i
i
i
i 
i!
i$
i'
n
o
o
o
o;
o>
o@
oC
oE
oH
oI
oK
oN
oP
oR
oU
oW
oY
q\
q^
q_
qa
qc
qd
qf
qg
qi
qk
qm
qo
qr
qt
qv
qy
q{
q}
q
r
r
r
r
r

r

r
r
r
r
r
r
w,
w.
w/
w1
w3
w4
w6
w8
w:
w;
w=
w>
w@
wB
wD
wG
wI
y;
y=
y>
y@
yB
yC
yD
yF
yG
yI
yK
yM
yO
yP
yR
yT
yU
yW
yY
y[
y\
y^
y_
ya
yc
ye
yg
yi
yk
yl
yn
yp
yq
yr
ys
yt
yv
yx
yy
y{
~
~
~O
~Q
~T
~W
~Z
~[
~^
R
T
V
W
Y
Z
\
^
_
a
b
d
e
g
h
j
k
m
o
p
r
s
t
u
w
x
y
z
|
}
	
 !#$&')*,-/0235689;<>?ABDEGHJKMNPQSTVWYZ\]_`bcefhiklnoqrtuwxz{}~	

!"$%'(*+-.0134679:<=?@BCEFHIKLNOQRTUWXZ[]^`acdfgijlmoprsuvxy{|~
 "#%&()+,./124578:;=>@ACDFGIJLMOPRSUVXY[\^abdeghjkmnpqstvwyz|}npsuwxz|~

!#&(+79	b	d	g	i	k	m	n	o	q	s	u	v	x	y	{	}





	








 
#
%
(
*
,
.
0
3
5
7
:
<
=
?
B
E
G
J
L
M
O
S
V
Y
[
\
_
b
d
e
h
j
m"%)-01369;=>?@CFILNQSUWY\_`bfgilorvy|~
#$()-.248:<@CEHLO!|	
 !#$&(*-0257:<?ADFIKNPSUX[^bcginruwz}	
!$'*-0#v#y#|#$$$$
$$$$$$ $"$%$)$-$/$1$3$5$7$9$=$A$C$F$H$J$K$N$Q$T$W$Y$[$^$`$c$f$i$l$o$r$t$w$y$}%%%%%%%	%
%
%%%%%%%%%%%% %"%#%%%&%(%)%+%,%.%/,n,q,t,w,z,~----
------- -#-&-*-.-1-4-7-:-=-?-C-F-J-N-R-U-X-[-^6^6`6b6f6h6j6m6p6s6x6{6}7777
777777"7%7)7-7074777:7<7?7A7D7H7J7M7O7P7T7VHgHjHmHpHtHwHzH}IIII
IIIIII!I#I%I(T9T:T<T=T?TBTETGTHTJTKTMTNTPTRTSTUTWTYTZT[T\T]T^TT`TaTbTcTdTfTgc	c
cccccc"c&c)c-c.c0c3c4c7c9c=cAcFcJcOcScXc\c`cdcgcjclco
k
m
o
q
s
u
w
x
{
}








 
"
&
*
.
3
6
9
=
@
D
F
H
J
M
O
P
S
V
Y
[
^
`
c
f
i
k
n
p
r
u
w
y
{
}



	



+R
+U
+W
+[
+]
+`
+c
+f
+i
+m
+p
=%
=(
=+
=-
=1
Eg
Ej
V$
V'
V*
V-
V1
V4
mq
mt
}







psuxz}	
 "$&')*+-.0134=x={=~>>>>	LELHLKLNLQLULWLZL]LaLdLhLkLnLqLtLwLzP'P)P+QAQCQFQHQKQLQNQRQTQWQXQZQ]Q^












 
 
!
!
"
"
#
#
$
$
%
%
&
&
'
'
(
(
)
)
*
*
+
+
,
,
-
-
.
.
/
/
0
0
1
1
2
2
3
3
4
4
5
5
6
6
7
7
8
8
9
9
:
:
;
;
<
<
=
=
>
>
?
?
@
@
A
A
B
B
C
C
D
D
E
E
F
F
G
G
H
H
I
I
J
J
K
K
L
L
M
M
N
N
O
O
P
P
Q
Q
R
R
S
S
T
T
U
U
V
V
W
W
X
X
Y
Y
Z
Z
[
[
\
\
]
]
^
^
_
_
`
`
a
a
b
b
c
c
d
d
e
e
f
f
g
g
h
h
i
i
j
j
k
k
l
l
m
m
n
n
o
o
p
p
q
q
r
r
s
s
t
t
u
u
v
v
w
w
x
x
y
y
z
z
{
{
|
|
}
}
~
~





		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



  !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~		



 -4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+]+]
-4ks+]-4ks+]-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+\~+\q+]-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+A+#X+I+#<+#`+S+[+#i+p+r+A+}++5+#l+++#p+9+	+#T+S++i+++;{+"f+#P+5+N+W+`+~++"+"b+#x+_+++;+.+$++5+7+d+++-+2+5+:+>+C+G+L+P+W+^+c+h+n+{+	+	8+
+
+	8+
i+Y+
p+
w+`+
~++g+
++n++!+u+(+/+|+6+=+
+D+K+
+R+
+
&+
-+
4+
+
+
;+
?+
H+
L+
Y+A+f+#+B+r+3+
+[+%+[+Q-4ks-4ks++,+A+/+N+4+7+=+@+C+%:+L+V++b+n+y++'+;+N+b+Bp+p+~+	++$+D+R+:++/.+W-4ks+Y+]+`+d+h+q+Cf+++"+1+>+C+F+H+K+M+P+k++++1+9+B+S+a+o+++;+E+Y+d+h+n+w+k+++%+:+R+g+9\+k+m+.+y+{+/+++++{+++,+3+:+G+T+d+T+d+t+w+"Z+u+
++$+1+1+|++*+C-4ks+M+,++S-4ks-4ks-4ks+_+~+"o-4ks+EI+/0-4ks-4ks+ES+/E-4ks+-;+IM+!t-4ks-4ks-4ks-4ks-4ks-4ks-4ks+!~+:s+"+*-4ks+"&-4ks+.+6l-4ks+:b+)~+$-4ks-4ks+._-4ks+.u+$$-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+<Q+#G+#\+#t+#|-4ks-4ks+(|-4ks+$+(7+(C-4ks+(b+$2+$M+$7+$=+$C+$G+$U+$c+$y+E9+%+E+E'-4ks+%J+E1+&V+A.+A?+Ad+B+El+B-4ks-4ks+'l+(-4ks-4ks-4ks+(g+($+(@+(B+Lu+E&+(e-4ks-4ks+)+EG-4ks+)W+)q-4ks+*+*+*L+I.+*[+*f-4ks-4ks-4ks-4ks+*l+*s+*|+G+,%-4ks-4ks-4ks-4ks+,(+,L+,4+,8-4ks-4ks-4ks-4ks-4ks+-+-!+-+-(+-.+-5+-B+-G-4ks+-M-4ks+-R+-[+-b+-l+-g+Hg+<Y+HI+;k+<;+<O-4ks+-t+.-4ks+.+. +.)+I+I +I-4ks-4ks-4ks+^u-4ks-4ks+.L+I-4ks-4ks-4ks-4ks+/+/
+/+/+/+/!+/"+/$-4ks+/,+:+9\-4ks+/2+13-4ks-4ks+/>-4ks-4ks+4n-4ks+/L-4ks+/U+/W+0+0-4ks-4ks+FT+3~+3y+4m-4ks+CM+3x+4W+4Z-4ks-4ks+4y+5
+5
+56+5@+5C+5E+5O+:g+5T+5V+5m+6+6+6R+6Z+6s+6|-4ks-4ks+9^+71+:"+7d+8s-4ks+=<-4ks+P+=s-4ks-4ks+>+>3-4ks+>7+>;-4ks+>c+?4+?F+?L+?T-4ks+?n-4ks-4ks-4ks-4ks++@-4ks+@#+@*+@<+Me+GP-4ks-4ks-4ks+A7+AL+AS+AZ+Ak+Aq+Aw-4ks+B8+BH+BV+Bf+C+C+EY-4ks+CD+CF+CH+CO+CQ+CW+C`+C}-4ks-4ks-4ks+E	+E!+E/+Eb+F^+G+G3+Gh+Gl+H+H+H"+H.+H>-4ks+HQ+I
-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+J<-4ks+I|-4ks+J+J
+J+J+J#+J)-4ks-4ks-4ks-4ks-4ks-4ks-4ks+Km-4ks-4ks-4ks-4ks+K6+K8+K;+K=++Kp+K{+K-4ks+L+L!+LJ+La+Lo+Lx+PD+M-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+)~-4ks-4ks-4ks-4ks-4ks+@E+(-4ks-4ks+Q-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4kq-4ks-4ks-4kq-4ks-4ks-4ks+
^+v-4ks-4ks+
-4ks-4ks+
^-4ks+
k+
d+ + + +
++%+#-4ks-4ks+I+~-4ks-4ks-4ks+@-4ks-4ks++Z++V+^++
+-4ks+U+X+[+^+a+d-4ks++#+,+-+3+N-4ks+`-4ks+~-4ks+)+ks-4ks+P-4ks+h-4ks++(-4ks+F-4ks+]+-4ks+9+B+U+^+h+u+"+;+X-4ks+w+U+7+s#+s-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+su-4ks+!+!G+!T+"8+":+"=+"@+"C+"F+"m+#-4ks-4ks+#Q+$+$+$/+$P+$q+%+%+%4+%H+%^+%{+&+&O+'+'+'$+'5+':+'P+'S+'V+'l+'t+'{+(+(+(1-4ks+([+(e+(h+(r+)-4ks+)-4ks+*#+*X+*p++++2-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+'l-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks++5+"+-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+0+0
+_+Gu+H+_J+_S+_Y+_h+_u+`+H_+Hj+Hp-4ks-4ks-4ks-4ks-4ks-4ks-4ks+-4ks+tk+v}-4ks+v|-4ks+v{+w+
+x<+x;+x+y1+y.+r-4ks-4ks+R+R+R1+R&+Rk+Rb+Qr+-4ks-4ks+Ji-4ks-4ks-4ks+Js+K+P!-4ks+K4+KL-4ks-4ks-4ks+Kd-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+LY-4ks+M*-4ks-4ks-4ks-4ks-4ks-4ks+Mc+s-4ks-4ks-4ks-4ks-4ks-4ks+Q+Q-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+P:-4ks-4ks-4ks+PM-4ks+PV-4ks+P^+Pg+Pn+P|+Q-4ks-4ks-4ks+Q!-4ks-4ks+Q&-4ks+Q+-4ks+Q0-4ks+Q5-4ks+Q:+Q?-4ks+QD-4ks-4ks+QN-4ks+QS-4ks+QX-4ks+Q]-4ks+Qb-4ks-4ks+Qi-4ks-4ks+Qr+Q{+R+R+R+R-4ks+R-4ks+R-4ks-4ks+R?-4ks+RJ-4ks+RU+R[+R+Rv+R~+S	+S
+`+au+`+`!+`-+`/-4ks+aQ-4ks-4ks+ay+ac+b+aw-4ks-4ks-4ks-4ks-4ks-4ks+|+~-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+5|-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+c\+g5+f-4ks-4ks-4ks+k&-4ks+jw-4ks+jN+j9-4ks+j+iw+i^-4ks-4ks-4ks+mu+m\+m<+m#+m
+o+o!+o8+ob-4ks+p"+q@-4ks-4ks-4ks+pC-4ks-4ks-4ks+q*+q,-4ks+r+vs+x+rE+ru+rx+s%+s(+sT+x=+t+t
+t:-4ks+t=+to+u+um+v+v+v+x+y+v,+v.+w~+y +vF+vH+w-4ks+wK+wa+wk+wy+x+x+x[+xy+x}+y+y+y
+y%-4ks-4ks-4ks+wy+y~+z +z&+z-+z>+zL+zY+zg+zt+{+{+{+{O+{8+{++{Z+{\+{j+|
-4ks+|+|,+|1+|5+|7+|;+|=+|?+|X+|Z+|c+|h+}+}+}4+}9+}J+}^+}j+}o+~e+~'+~_-4ks+~k+&+"+x-4ks++++
+
+++++++:+H+V+e+s+++++ +<+@-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+/+	*+E+	#-4ks+Q+<+		+e+	+z+	++W+:+P+Z+_+y+f++n+8+|+X+f+-4ks+
-4ks+
o+i+'-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+*+0+6+<+B+H+N+Y-4ks+a++U+I+
C+
d+
t++6-4ks+G+I+J+L+M+O+U+p-4ks-4ks++8+[+q-4ks-4ks+~++/+h+y-4ks+%+-4ks-4ks-4ks-4ks-4ks-4ks+U-4ks+z+.+k+++=-4ks+Z+b+-4ks-4ks-4ks++-4ks+}++l-4ks+5-4ks-4ks+S+$++@+9+Z+;-4ks+++G-4ks+
+K+'-4ks+R-4ks++y++Z+r+(+0-4ks-4ks+P+\-4ks+R-4ks+T-4ks+-4ks+	+<-4ks-4ks-4ks-4ks+-4ks-4ks-4ks-4ks-4ks-4ks+N+3+4)+8-4ks+41-4ks-4ks+&l+ -4ks+&)-4ks-4ks-4ks-4ks-4ks-4ks-4ks+ -4ks++V++,m+>"+F++SG+W+ih+l(+n+~I+_+
Z+q+S++ R+++8
+!+!D+,+9+"+"r+#+#5+Q+$+!]+/k+A+Gs+Tc+ZM+j~+m
+n{+++\++N+G-4ks+%3-4ks-4ks-4ks-4ks+%B-4ks-4ks-4ks-4ks+%P+'+%Z-4ks+&z-4ks+%~+(t-4ks-4ks-4ks-4ks-4ks-4ks-4ks+&c+&E-4ks+&U-4ks-4ks+&N-4ks-4ks+'	+'-4ks+'_+'h-4ks+(+)Q-4ks-4ks-4ks-4ks-4ks-4ks++
@-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+p
-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+p-4ks-4ks-4ks+-h-4ks-4ks+.+.+/j+.'-4ks-4ks+.c+/^-4ks+4+0+0{+2
-4ks+2.+2^+3-4ks+3I+3O+3^-4ks-4ks+3t+C-+4+CU+4-4ks-4ks+4q-4ks-4ks-4ks+7Z+7\+7s-4ks+80+8s-4ks+9<+9t+9v-4ks+:+;Q+:t+;+<[+>h+>+>*+@r-4ks+D'-4ks+DH+E-4ks+E,-4ks+En+U-4ks-4ks+F4+GG-4ks+G_-4ks-4ks+H+H:+HG+I/+Ic+J0+Jr+KP+Kp+L+L:+Lg+MA+NN+OE+Pv+Q+QB+Qb+R+R0+S9+Rd+S
+Su-4ks-4ks-4ks+Tl-4ks+T{+X[+`+T-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+cq-4ks+d+hV+l]+nB+pX+tw+x+|K-4ks-4ks-4ks-4ks-4ks-4ks+f +Q+j2+mL+o0+rO+v3+>+z+++
++
-4ks+++U-4ks+	-4ks+-4ks-4ks-4ks+%-4ks+7-4ks+J-4ks+\+c-4ks+o+v-4ks++-4ks+-4ks+&+0+c+p+-4ks-4ks+-++DX+D4+E+Ix+N+ah+I+^s++`?+dg+p+uU+u++%++n+}+++2+t+4-4ks-4ks+f+-4ks+
+-4ks+3+#D-4ks-4ks-4ks-4ks+A2+@r+A%-4ks+')+-y+&C+O6+&V-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+G%-4ks-4ks-4ks-4ks-4ks-4ks-4ks+3+?=+@V-4ks-4ks-4ks+5:+9w+9s+}Y+@"+AI+b@-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+}+?X+A^+HC+Hl+J.+Zk+JG+r1++b\+[u+\s+^+}H+F+>+}]+|+^R+K++Y[+8B-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+;5+<s+-4ks-4ks-4ks-4ks+s+\+!e+$S+'+)I+--+0{+28+9q+<h+g-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+>"+@M+C@+Er+IA+>-4ks+M-4ks-4ks-4ks-4ks-4ks+M%+M3-4ks-4ks-4ks-4ks+Mv-4ks-4ks-4ks-4ks+N?+R-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks-4ks+Sa-4ks-4ks-4ks-4ks-4ksyHELPFUNCTION*EXITLISPSCREFCREFOFFTSYSLISPTVALUERCHAR-MACRORIESCHARDOCHARCNTRLCONTROLCHARERRORMETALOWERRUBOUTRUBSPACEBLANKESCAPEESCCRFFEOLLFBACKSPACEBELL  +m</
	8</<@> Bx @ @6	d0V+	G 	g,kv  D3D+	A +	c x,j1Z$@ B,j~3B+	E +	c x>~+m!6	d0V+	Y  D   Bx3D	f+	:2D	f+	O,	9Z$>~+kE 	e ,k3B+	T x,	9Z$>~+kD 
2L	e+	X x,	9Z$@>~+kE x>~+m!6	d1V+	\0v+	b,jh2B+	bZ$ x,jg2B+	bZ$ x>~+jj x>~+m!>~,~<<0
	7<1<{<'*** Unknown character constant: %r  	o,kB@@,~<
	gGC-TRAPHEAP-WARNING-LEVELDBUG-MAIL-TO-LEVERSIONNAME-LENEWTOOLS2RULE-OR-TERM-USEDd CHECK-PARSER-TYPEIN	CHECK-PARSER-GRAMMARo reRULE-CHECKON-TRULETERMINALCHECK-RULE-BODYEINREPEAT*KEOPT*TPPN*TPP*CURL*N-TTPP-DO*ITCHANNELTPPS-FUCHANNELUPRINTAUPRINTPRIUNQUOTEDUNQUOTELUNQUOTEBACKQUOTECHANNELUREADHATPP$UREADFIXHAUREADLREATPP$PRINLEVELTPP$PRINLENGTHTPP$BLDMSGGTHLETCLCOMPZETANP3IFUnused %p: %p.%nd ,> 
;,kv3B+
8 
: x,kv2B+
7 
; x,kv x  
:,kW+
8 +
9 >,~

+<:<: 
=+lo<: 
?+lo<:Checking for unused terminals and rules:%nUndefined non-terminals in GRAMMAR:%n-8Duplicate RULEs in GRAMMAR:%nDuplicated RULE in TERMINALs list:%nn-8%nNT%p TDuplicates in TERMINALs list:%np.%	Parse-check failed!Unterminated %p entry, missing %p.%nn-8> Bx D     B D~ F~ H}  
 L}6m0V+
h } +
i  B|6m1V+
l +
x u |,kv2Bu+
p  |,j< B u u |,k }  B}6m0V+
v +
w  B|+
i   x B} D| F|2@}+
} 
9+ 
}6n0V+
 } ,lN,k	,lQ B| }  B}2B+ | | t,kW t,j? } 
|3L8++ }   B| u,kv2Bu+ ~ }  ,j< B~+ u }  ,kv2Bs+ ~ }  ,j< B~ s u }  ,k }  B}+
{ x,m, B}3@+1 s,kW  B} 
 L}6m0V+% } +&  B|6m1V+) +0 | r,kW }  B}6m0V+. +/  B|+& r,kW3@~+C q,kW  B} 
~ L}6m0V+8 } +8  B|6m1V+; +B | r,kW }  B}6m0V+A +A  B|+9 r,kW3@~+V q,kW  B} 
~ L}6m0V+J } +K  B|6m1V+N +U | r,kW }  B}6m0V+S +T  B|+K r,kW3@}+h p,kW  B} 
} L}6m0V+] } +]  B|6m1V+` +g | r,kW }  B}6m0V+f +f  B|+^ r,kW p,kW o,lz o,lz n>{+lz<}<<0

>

<

.

?

D

I

L

Q

R

S<<

W

Y<<<:> Bx    B D F~ H~2@+} ~+
 
6
0V+
  ,lN,k	,lQ B~   B 
~3L+
+
    B  B}   ,m. B}6
0V+
 +
  B}6
0V+
 ~ },j< B~ }  D}6
0V+
 +
  B}+
   B+{>|,~<0<<}<> Bx  
x L6
X0V+
"  +
#   B D~6
X1V+
' ~+
W  
 L~6
Y0V+
+ ~ +
,   B} D}6
Y0V+
R6
Y1V+
8 
] },kv B}2B+
6 ~ },j< B~+
L 
9 
\ },k+
L } 

\3L8+
< } 

[2L8+
L  B| } ,jG,
 B|6
Z0V+
B +
C  B|6
Z0V+
L ~ |,j< B~ |  D|6
[0V+
K +
K  B|+
C ~  B~6
Z0V+
P +
Q  B}+
-   B6
Z0V+
V +
V  B+
$>{,~<<~<}<<|<<=<><:<:,>@@-4kN?)%n . > Bx D3B+
q6+
q  ,k
+  B D~Z$ N,jz B~ Z" B} D} } },jg3B+
{ +
~Z$ ,k$ },ji B}+
w1~+ ,k$Z$ ,k$  x B~ D}6
?,k#,~,m1++B|,D|+| |,jg2B+

9 L  },
k-4kP 

93L~+~,,B~+Z"+B} D} } },jg3B+
i
j+N,.AN,@AN> Bx D61V+
$bDnBD~F~2@+,j~3B+
~1L+
~0L+,j~2B+

93L+~,k,B~+k+,x,k+,B2B+ x,
~60V+Z$ x,k$ ~  B~+ >},~<x<~<0
A
B<A
C<B<B<C<{,> 
9-4kND x,l/-4kP,m5>,~ ;+m4> Bx6A1V+*6A0V+@>+j9 B2@+, x+@ 
6A0V+1  ,j9  B8 
6B0V+5  ,%+9 
6B0V+9  ,j9  B86B0V+> 
6A0V+>  +?  B+*>,~<<0<0<
D
E<S
F
G<@<E<@<S
H<E<@  N,j|  M M+jf<F
C<M<E<@<E<@<?<@<G
R<G
S<H
T<H<@USEFULmp.CLCOMP1p.BACKQUOTE-FORMBACKQUOTE-VECTORBACKQUOTE-LIST	BACKQUOTE-CONSTANTPBACKQUOTE-CONSTANT-VALUEQUOTED-LISTQUOTED-LIST*LIST*	CHAR-PREFIX-FUNCTIONquot	BACKQUOTE-READ-MACROUNQUOTE-READ-MACRO	UNQUOTEL-READ-MACRO	UNQUOTED-READ-MACRO	FUNCTION-READ-MACROEVAL-READ-MACRO*READ-SUPPRESS*-MAC	IF-SYSTEM-READ-MACROIF-NOT-SYSTEM-READ-MACRO
SINGLE-CHAR-READ-MACROCHAR-READ-MACRODESTRUCTURE-FORMFLATTEN***DEFMACRO-ARG***DEFMACRO-1	*DEFMACRO-DISPLACESMACRO-DISPLACE*MACRO-DISPLACEMACROEXPAND1%DISPLACED-MACRODEFMACRODEFMACRO-DISPLACE	DEFMACRO-NO-DISPLACE***DESETQ-VAR***DESETQDEFLAMBDA*MACRO-DEBUG***XOR-ARG***XORWHENUNLESS***PROG1-VAR***PROG1LET*LET*1SETF2SETF1***SETF-VAR***EXPAND-SETFSETF-SAFEOPLHSRHSCAR-CDR-SETF	***PNTH-SETF-VAR***EXPAND-PNTH-SETF*SETF-DEBUGFLAG-SETFGETD-SETF	***LIST-SETF-VAR***LIST-SETF	***CONS-SETF-VAR***CONS-SETFVECTOR-SETF
***VECTOR-SETF-VAR***PUSHPOPADJOIN-TOADJOINQ-TOINCRDECRPSETQPSETFDEFSWITCH***DO-LABEL***DO*DO-LOOPDO-LOOP*FOR-BUILD-LOOPFOR*FOR-RESULT*FOR-EPILOGUE*FOR-BODY*FOR-CONDITIONS*FOR-PROLOGUE*FOR-TESTS*FOR-VARS*FOR-OUTSIDE-VARS*PROCESS-FOR-CLAUSEFOR-FUNCTIONFOR-IN-FUNCTIONFOR-ON-FUNCTIONFOR-FROM-FUNCTIONFOR-FOR-FUNCTIONFOR-WITH-FUNCTION
FOR-INITIALLY-FUNCTION	FOR-FINALLY-FUNCTIONFOR-DO-FUNCTION	FOR-COLLECT-FUNCTIONFOR-CONC-FUNCTIONFOR-JOIN-FUNCTIONCLAUSERESLTDEF-FOR-BASIC-RETURN-FUNCTIONFOR-UNION-FUNCTION	FOR-UNIONQ-FUNCTION
FOR-INTERSECTION-FUNCTION
FOR-INTERSECTIONQ-FUNCTION	FOR-ADJOIN-FUNCTION	FOR-ADJOINQ-FUNCTIONFOR-COUNT-FUNCTIONFOR-SUM-FUNCTION	FOR-PRODUCT-FUNCTION
FOR-MAXIMIZE-FUNCTION
FOR-MINIMIZE-FUNCTION	FOR-MAXIMAL-FUNCTIONUNC	FOR-MINIMAL-FUNCTIONUNC	FOR-ALWAYS-FUNCTIONFOR-NEVER-FUNCTION	FOR-THEREIS-FUNCTION	FOR-RETURNS-FUNCTIONFOR-WHILE-FUNCTIONFOR-UNTIL-FUNCTIONFOR-WHEN-FUNCTION	FOR-UNLESS-FUNCTIONFUNCALLEQFIRSTBLDIDNARY-CONCATDEFSTUBSTUB-PRINT***CIRCULAR-LIST-ARG***CIRCULAR-LISTNOTHINGMAKE-LISTMAKE-LIST-1MACROEXPAND	MACROEXPAND-SIGNAL*MACROEXPAND2MACROEXPAND-FUNCMACROEXPAND-CONDMACROEXPAND-PROGMACROEXPAND-LAMBDAMACROEXPAND-RANDOMMACROEXPAND-LOOPBANG#.,@EXCLAMATIONFUN#/,.ATLA#'ATSIGNTIO#+SHARPTIO#-POUNDTIO#\NUMBERNUMBER-SIGNFUNHASHNOT-EQUALDOLLARALPERCENTLCARETTLUPARROWLAMPERSANDSTARLPARENNDLEFT-PARENTHESISIONLEFT-PARENHESILPARRPARENRENRIGHT-PARENTHESISONRIGHT-PARENHESRPARDASHUNDERSCOREHESUNDERLINEBACKARROWEQUALSOWTILDEOWLBRACETELEFT-BRACEHESRBRACEACERIGHT-BRACEHESLBRACKETCLEFT-BRACKETESLBRARBRACKETKRIGHT-BRACKETSRBRAAPOSTROPHEETSSINGLE-QUOTESQUOTE-MARKESDOUBLE-QUOTESSTRING-MARKSCOLON-MARSEMISEMICOLARSEMICOLONQUESTIONQUESTION-MARKSQUESTIONMARKSLESSLESS-THANLANGLEANLEFT-ANGLEKSLEFT-ANGLE-BRACKETNGREATERLEGREATER-THANACGRTRRANGLE-THRIGHT-ANGLEAC	RIGHT-ANGLE-BRACKETCOMMAANGLDOTAPERIODNGLFULL-STOPSLASHTOPSOLIDUSPBACKSLASHBARSVERTICALVETICAL-BARBRAZERONAUGHT-BAONETWOHTHREE-BAFOURFIVESIXSEVEN-BAEIGHT-BANINECALLUNTILRETURNINGRETURNSTHEREISNEVERALWAYSMINIMALMAMAXIMALMIMINIMIZINGMINIMIZEMAXIMIZINGMAXIMIZEPRODUCTSUMMINGSUMCOUNTINGCOUNTJOININGCONCINGCOLLECTINGDOINGFINALLYINITIALLYWITHASFROMIPUTSIPUTVIGETSIGETVCOMPFN&COMPROGN^?LI^/LI^LI^~LI^^LI^]LI^\LI^[LI^ZLI^YLI^XLI^WLI^VLI^ULI^TLI^SLI^RLI^QLI^PLI^OLI^NLI^MLI^LLI^KLI^JLI^ILI^HLI^GLI^FLI^ELI^DLI^CLI^BLI^ALI^@LISPIUSIRSIGSIFSIEMICANIETBISYNINAKIDC4IDC3IDC2IDC1IDLEISIISOINPIVTINLIHTIBSIBELIACKIENQEOTIETXISTXISOHINULI  +m;
<*
<A<@<@<@> Bx6U0V+>+m;6U1V+6U0V+ Y,k2B+ x>+jf x+T 
Y2L+!  +T 
X2L+%  ,+ X ,k3B++ x W,j> Z"1,jg x+T x  B6U1V+/ +0 
93B+4  3BW+4 +4 
93B+? x3@8+< x ,  x    V>+jf x   +T x  B6U1V+C +C 
93B+H  3BV+G +H 
93B+R x3@8+P x ,  x    U>+jf x   +T x>+m<>,~<<<A<X<B

<C<B
> Bx,j@ 
9  B D F~ B~ ~,jh3B+b +k ~ x,j>,m; B} ~3B+g },m< B~  },j< B ~,k B~+_3@~+{ ,k: @@ B~ D}  ~,jg3B+s +z  ,m=  ~ },j@   B ~,ji B~+o }+}  ~>}+j<>},~<N<L
<z
<M<@<M<@> Bx ,m; B x ,m;   B D~2D+,m<3B+ ,m=  R>}+jm  R>}+jm  B~6M1V+ + 
92B+ 
96N1V+ 3B+ + 
93B+# ,m<3B+  ,m= ~  Q+J ~  Q>}+jf6N0V++ P ~ ,k3B++ ~  ,j< ~ >}+j|6O0V+9 P ~ ,k3B+9 ,m<3B+6 ,m= ~ ,j< ~ >}+j| ~,m=,jf +K ~ B~6M1V+< += 
93B+A ~ 3BO+A +A 
93B+K ,m<3B+H ,m= ~    Q+J ~  Q>}+jf ~  Q>}+jf<<~<<~<{
~
<M<M<z<L<{
T<L
U<M<@6]0V+Y ] +k6]0V+\ ,~ 
9,~<
S,>,>61V+b +b 
93B+g  3B+f +g 
93B+j x  + x B61V+m +n 
93B+r  3B+r +r 
93B+u x + x B61V+x +y 
93B+}  3B+} +} 
93B+  x 
,k  + x>,~<<M<L<{ +jf 	 +k
<K>nBx60V+,,k	 Bx, B @Zx+D61V+ +   B~ ,j< B   D+ >~+jf >~,~<<
  +m> Bx6K0V+3 L,kv2B+J x,j1 BZ$@,j~3B+1 +1 2B+J+H6K0V+?6K0V+8 L ,kv+8  B3B+> x  ,(  
,k+H x>+m!6K1V+B0v+H,jh2B+HZ$ x,jg2B+HZ$ x>+jj+J x>+m!>,~<<<N<'*** Unknown character constant: %r  T,kB@@,~
M,l-  W+jm<C,l-  Z+jm<B,l-  ]+jm<B,l-  `+jm<A,l-  c+jm<~,l-2@a+f+js ,~> Bx61V+k  >~+k 
2L+  B x  B60V+q +r  B61V+u 
9+} ,g3B+x +}   D60V+| +|  B+r2B+ 
9+ 
2L+  B x  B60V+ +  B61V+	 
9+ ,g3B+   D60V+ +  B+ 
2L+  ,g2B+ 
9+ >~,~<<<<<<,>,l-,g2B+! 
9-4kNQ x,l--4kP x,l->,~,>,l-,g3B+) 
9-4kNQ x,l--4kP x,l->,~+l,l-2@a+/+m ,~Can't assign to %r> Bx D2B+6 +J6K0V+;   M,jf>~+jG6K1V+A  L,j> x Z"1,jg +3 L,jm  x ,3 B  K,jm  x ,3  >~+k>~,~<<^<]
0<> Bx2B+Q +\6]1V+S>+jG2@+W ,N >+j| ,N B x ,N  >+jI>,~<<U<@<^
]> Bx   ,mE B } x   ,mE B3@e+m x    },j<  | |,jf+p x    },j<  {,jm,jG  ,k ,j| {,j|  z x   z>~+jn<
]<<<V<U<
^> Bx D3@f+
  ,j<  
,jm B  ,mH   ,jf  x>~+k >~,~<X<{+mF,> 
9-4kNV x,mF-4kP>,~,> -4kNV x,mF-4kP>,~<Z<@> Bx   D    F % ,mE %,k %,j| $,j| >~+jm<~
<Z> Bx   D    F      H~3@k+2  ,j< ,j| :>~+j| : 9,jn ,j< 9,j|    8>~+jn<X<z<M<~<|> Bx   D    F      H~2H+F  ,jm  L>}+jm  ,jm B~ ~ 
9,j<  ~ L>}+jf<<\<@
O
M<
M> Bx   D    F \ ,j< \,j|  [ [,jf >~+jm<~
M<H
N> Bx   D   F  ,j<  e>~+jm<> Bx   D   F n,jm ,j<  n>~+jm<<<^<@> Bx   D   F2F+v +{ } ,jI },j| |,j| >~+jm>~,~<~
o> Bx   D   F2D+
2F+ +"6#0V+2@+ +"  %>|+j< @~ @~ @} D}6#0V+ }  B}6$1V+ ~,j< B~ ~ + ~ ,j< B~ } 3B+  ~,j< B~ }  D}+
 ~,k ,j< $,j| B} ~,k }>|+j|>|,~<<}<<~<,>   
   2D+22F+, +4650V+02@+0 +4  5>+j<  >+mP>,~<<> Dx   B D6J0V+; ,jG B~3@+@ x ,6,jG+@ x ~,j| K,j| B~6K0V+H 3@8+H   +H   ~>~+jm<<<~Odd number of arguments to setf.r> Bx  D6`1V+U +_6a1V+X b>+j? 
6a1V+]    >+mQ ,mQ b>+j|>,~<<<0<
LOdd number of arguments to setf.r> Bx6u1V+k +t6u1V+n v>+j?   ,mQ B x  ,g >+j|>,~<<
c<a<@> Bx D61V+}   >~+jf60V+  ,ll3B+  x>~+mR61V+	  x,mR   >~+jf  ,jm,jG B  x,mR ,j< ,j| >~+j|<<<<F
v<a<<b<%r is not a known form for assignment-8> Bx D   B-4kNb6G0V+' J,kv  Dr3D+' ,jG  x ,jI r,j|+E6G0V+. I ,kv Br3B+.   x 
,k+E6G0V+> ,k Br3B+> B~6G1V+5 +6 
93B+: ~ 3BI+: +: 
93B+> r  x 
,k+D  x H,jf  H,j> x Z"1,jg ,-4kP>~,~<<
<h<<i<i<c
K<c<@
M<@<p
N<c<@> Bx   D    F c,jm B~  c,jm c,j< b,j| b,j< ~,j| b,j|  a a,jf  `>~+jm<~<~
J
K<z
L<{<W
f
g<@<d<@<.
f> Dx      B D ,kH3B+q x  +61V+s0v+y  ,jm   ,jf x  + u-4kNr ,kj B~2@	+ x ,mQ,jG B~ ~,kk ~-4kP B~61V+
  ,jm x   ,jn  ,jm+  ,jm,jG B~  ,j< ,j| x  ,jf  ~   ,jn  ~ ,jf>},~<<<F<H
d
e<d<x<_</<.<h,>3F+!,jG x,lm 
9+#,jG x,ln >,~
%r is not a funtion spec. ass> Bx D6B1V+5  B6B1V+/ +/ 
93B+4  3BD+3 +4 
93B+9  C x,jn  C>~+j<6B0V+=   x,jn +A C,j>  Z"1>~+jg>~,~<<
$<{<~<g<@> Bx D6U1V+N ,mE B ,jG  ,k W+T W,jm,jG B W x ,mE V,k ,j| V>~+j|<<F
D<g<<h<@
[<@
\<@<^
X<]
X> Bx D6{1V+m ,jm  x   ,jf B  ,jm  x    ,jf    ~>~+jn ~,jm,jG B } x  ,j< ,j| B~ } x   ,j< ,j| |,j< ~,j| ,j| |>~+j|<<F
X
Y
Z<h<<^<h<]> Bx D641V+ + 8 B  x  B~640V+
 +   @@ B~ D} F} H|651V+ }+'3@|+ }  7,jf  ~ 7,jf,jG | B8 |  B|+ }  7,jf  ~ 7,jf,jG B| B} },ji B| ~  D~640V+$ +%  B~ | B}+ B~651V+, ,jG  ~,k 6+3  8,jm,jG B~ ,jG  ~,k ~,j| 6>{+j|<<<~<<F<<h<M<i> Bx   D    F A,jf   A>~+jf<h<K> Bx   D   F T,jm B~  S,jm   S,jf  ~ R,jf3@+Q    S>~+jf>~,~<^<h<^<]> Bx   D    F ],jf   ]>~+jf<h<9> Bx   D    F g,jf   f>~+jf<h<9> Bx   D   F3F+p  ,j< t,j|+q t,jm   s>~+jf<h<x<> Bx   D   F3F+~  ,j<   ,jf+ ,jm   >~+jf<h<.<w<> Bx  D @~ @~ D61V+
 +   ,jm B~,k B~   D60V+61V+ ~+   ,jm ~ B8 ~,k B~   D+ >}+j|<<<hpsetq passed an odd number of arguments> Bx  D2D+& +3 3@8+/   6,j<     5,jf    5>+jf3@+2 5>+j< 4>+j?>,~
<<^<mpsetf passed an odd number of arguments> Bx  D2D+? +M 3@8+I   O,j<     O,jf    N>+jf3@+K N>+j< N>+j?>,~
6<h<^<m
T<@
U<@%w-SWITCH-VAR*<{
V<{
W<b<@<i<@> Bx   D    F      H~60V+a  +b  B~60V+e  +e   ~ B} D}2F+k  ,j>,l5 B ,jG  ,jm  ,jm B|  ,jm,jG }  ,jf 
    ,k? B|  ,jm ,j< ,j| B{ ,jG B{   ,jf,jG  },jI {,j| ,j|  ,jm  { ,jf B{ ,jG  ,jm ,j< ,j| 
 { | | >z+k?<<<|
P<h<~<~<<
Q<|<F<<{
R
<@<
<n<@> Bx   D    F      H~   B~ D} @| @| 
 L}6n1V+& +Q }  B{6n0V+73@+7 3@8+76o1V+. +/   B{ {   ,j< {,j| B} {   { ,jm,jG 
 J| J| }  B}6n1V+= |+Q  B{6n0V+M3@+M 3@8+M6o1V+D +E   B{ } {   ,j< {,j| B} {   { ,jm,jG | B8 |  D|+9 B~ 2@8+T +\ 
6o0V+Z  82@8+Z   +\   s,j<  s,jm   ,jm  r,jm B} } r,j< q,j<  ~,jI },j| q,j| ,j| p,j|3@~+m  ~ p>z+jf>z,~<}<<<0<F<<n
<m<<<
u<@<
v<n<@> Bx   D    F      H~   B~ D} @| @| 
 L}6L1V+ +/ }  B{6L0V+3@+ 3@8+6M1V+
 + {     Q,jf },j< B} {   { ,jm,jG 
 J| J| }  B}6L1V+ |+/  B{6L0V+,3@+, 3@8+,6M1V+# +$   {     Q,jf },j< B} {   { ,jm,jG | B8 |  D|+ B~ 2@8+2 +: 
6M0V+8  82@8+8   +:   Q,j<  P,jm   ,jm  P,jm B} },k O,k  ~,jI },j| O,j| ,j| N,j|3@~+K  ~ N>{+jf>{,~<}<<<0<_<<n
t<<<<
S<@<
T<n<@> Bx   D    F        H~ 
 
( 
( 
( J~   B} D} @| @{ 
 L|6.1V+e + |  B{6.0V+v3@+v 3@8+v6/1V+m +n   Bz {   ,j< z,j| B} {   { ,jm,jG B{ B| |  B|6.1V+{ |+  B{6.0V+
3@+
 3@8+
6/1V+ +   Bz } {   ,j< z,j| B} {   { ,jm,jG { B8 {  D{+w B} ~2@8+ + 
~6/0V+ ~ 82@8+ ~  + ~  3,j<  3,jm  ~ ,jm  2,jm B| } 2,j< 1,j<  ~,jI |,j| 1,j|  ,jI ,j| 0,j|3@}+-  } 0>z+jf>z,~<|<<<0<F<<n
R<m<<<
5<@<
6<n<@> Bx   D    F        H~ 
 
( 
( 
( J~   B} D} @| @{ 
 L|6 1V+G +r |  B{6 0V+X3@+X 3@8+X6 1V+O +P   {      ,jf },j< B} {   { ,jm,jG B{ B| |  B|6 1V+^ |+r  B{6 0V+n3@+n 3@8+n6 1V+e +f   {      ,jf },j< B} {   { ,jm,jG { B8 {  D{+Z B} ~2@8+u +} 
~6 0V+{ ~ 82@8+{ ~  +} ~   ,j<   ,jm  ~ ,jm   ,jm B| },k  ,k  ~,jI |,j|  ,j|  ,jI ,j|  ,j|3@}+   }  >z+jf>z,~<|<<<0<_<<n
4<<<<     +ma<o<F 
       +ma<p<_For loops may only return one valuents> Bx D F ,jG B~ ,jG B~ ,jG B} ,jG B} ,jG B| ,jG B| ,jG B{ ,jG B| 
{ L| 
| L| 
| } } ~ ~-4kN@q8r0r(s sttu 
x L{6 j1V+ > + A { ,mf {  B{+ ;   B   D   F    H 
 
( J   B   B   B3F+ R3@+ Q   l,j<+ R  B3@+ [ 3@8+ W   l,j<+ X   B ,j<  k,j|,jG B3@+ _ 3@8+ _  k,j?  ,k ,j| ,j< ,j| ,j| ,j|3@+ h   ,jf-4kP>z,~<{
 <]<<Unknown for clause operator: %r..For clauses may not be atomic: %r.,>6!	1V+ {  !
,j> x Z"1,jg, u  x -4kNb !
 r,kv3B+!  x  
,k+! r !	,j> r Z"1,jg-4kP>,~<
 m<v
 q> Bx  3B+!  B,lg   x   x  B D~ F~ H}  ,jG ~ } !F,jf B} } !E,jm B|3@~+! } !E,jm  ~+!  } !E,jm  |,jm B|  
9,jm  | !D,jf  } !D,jf B} } !C,jm  } !F,jf B| } !E,jm B|3@~+!3 } !E,jm  ~+!4 } !E,jm  |,jm B|  
9,jm  | !D,jf  | !D,jf  } ,jf  ,jG } !C,jm  >{+jG<r<^<<<]<\<h>    Bx D  !S,jm   x,jf  ,jG x !R,jm  >+jG<r<^> Bx  B6"20V+!X  B x  B~6"20V+!^  ~  D~2B+!_Z" B~6"30V+!d ~  ~  D~+!d  B}3B+!i6"21v+!i1V+!i,lg+!j  B}6"30V+!m ~ +!nZ" B|3B+!s6"21v+!s1V+!s,lg+!s  B|3B+!w   "7+" |,j{3B+!z +" |,kH3B+!~  "6,jm+"O@ |,jR3B+"  "6,jm+" |  "5,jf,jG ~,j| ,j|  ,jG3@}+"
 } },jm  ,jG3@|+" | |,jm  ,jG 3@|+"! | "5,jm B{ }2B+" }   "4,jf  {,jm B{ }2B+" }   "4,jf  
9,jm  { "3+"/ 
93@}+"#3D+"%+"1|,jh3B+"+}2B+")}"4+"/}2B+"-}"4,jf>{+jG>{,~<<~<<v< B D x3@8+"O x   D  "l,jf  +"S,lg B  ,jG  ,jG  ,jG x  "k,jm   "k,jf  "j,jm   "l,jf  ,jm B~ x  "k,jm   "l,jf   "l,jf  
9,jm  ~ "j,jf  >~+jG<<^<_<V<h> Bx,lg   B D x3@8+"w x   B   #,jf  +"{,lg B  ,jG  ,jG  ,jG x   #,jf  #,jm   #,jf  ,jm B~ x   #,jf B~  #,jm   #,jf  ~ 
9,jf  ~ #,jf  >}+jG<<-<_<h> Bx,lg   B D x3@8+# x   B   #>,jf  +#",lg B  ,jG  ,jG  ,jG  x  #>,jf   #=,jf  #=,jm   #>,jf  ,jm B~  x  #>,jf   #>,jf B~  #=,jm   #>,jf  ~ 
9,jf  ~ #<,jf  >}+jG<<-<_<X<h<|<@
#G<@<]
#?<h
#H
#I<@<^
#?<h
#J<{
#K<|<@<|
#L<V
#M<|
#N<h<@
#O<@<q
#G
#P<@<v<@<p
#?> Bx   D    F        H~ 
 
( 
( 
( 
( J~       B} $ $ $,jn  $ $,jf  $ #,jf B} ~ $ $,jf  # $,jf #~,j< #~,j| 
9,j|  } #},jf B} } ~ #},k	   $,k	  #| $,jf  } #| #{,jn  #{  #z>|+jn<|
#?<F
#@<r
#A<
#B
#C<t
#D
#E<V<s<z
#F<|> Bx  B x3@8+$
 x   B   $,jf  +$,lg B ,jm  ,jG  ,jG x   $,jf   $,jf  >+jG<:<h> Bx  B x3@8+$" x   B   $.,jf  +$',lg B ,jm  ,jG  ,jG x   $.,jf   $.,jf  >+jG<:<h> Bx,lg   B D x3@8+$: x   B   $O,jf  +$=,lg B  ,jG  ,jG  ,jG x   $O,jf  ,jm B~ 
9  $O,jf x   
9,jf  ~ $N,jf   $O,jf  >~+jG<<<<h> Bx,lg   B D x3@8+$[ x   B   $p,jf  +$^,lg B  ,jG  ,jG  ,jG x   $p,jf  ,jm B~ 
9  $p,jf x   
9,jf  ~ $o,jf   $p,jf  >~+jG<<<<h> Bx  B x3@8+$z x   B   %,jf  +$,lg B ,jm  ,jG  ,jG  x  %,jf   %,jf  >+jG<9<h> Bx  B x3@8+% x   B   %,jf  +%,lg B ,jm  ,jG  ,jG  x  %,jf   %,jf  >+jG<9<h> Bx  B x3@8+%& x   B@@  %3,jf  +%+,lg B@@,jm  ,jG  ,jG  %3,jm  x ,jm  %2,jm  >+jG<<l<h> Bx  B x3@8+%= x   B@@  %G,jf  +%B,lg B@@,jm  ,jG  ,jG x   %G,jf  >+jG<l<h> Bx  B x3@8+%Q x   BZ&  %],jf  +%V,lg BZ$,jm  ,jG  ,jG x   %],jf   %],jf  >+jG<<h> Bx  B x3@8+%g x   B   %z,jf  +%l,lg B ,jm  ,jG  ,jG x   %y,jf  ,jm B x  
9,jm   %y,jf   %z,jf  >~+jG<<<h> Bx  B x3@8+& x   B   &,jf  +&,lg B ,jm  ,jG  ,jG x   &,jf  ,jm B x  
9,jm>B&,jfBB&,jf>~+jG<< F} H} x3@8+&( x 83@8+&( x    B~   &N,jf  +&,,lg B~  ,jG ~ ,jG ~ ,jG } ,jG } ,jG x   } &N,jf  ,jG ~ &M,jm B| 
9 ~ &N,jf  |,jm  &M,jm B| } } &L,jf  | &L,jf B| } } &N,jf B| x  ~ &N,jf  | |,jf  &M,jm  >{+jG<<v<<<h> Bx,lg B,lg B,lg     B~ D~ F} H} x3@8+&` x 83@8+&` x    B~   ',jf  +&c,lg B~  ,jG ~ ,jG ~ ,jG } ,jG } ,jG x   } ',jf  ,jG ~ ',jm B| 
9~',jf>|,jm',jmB| } } ',jf  | ',jf B| } } ',jf B| x  ~ ',jf  | |,jf  ',jm  >{+jG<<
   ',jm Bx  ',jm  x,jm  ',jm  ,jG 
9 >+jG<<<s<>3@+' '#,j|+'  Bx  '#,jm  x,jm  '",jm  ,jG 
9 >+jG<<<> Bx,lg B  ,jG  ,jG x   '4,jf B  '3,jm  ,jm  '3,jm  >~+jG<<<h3@+'7 '9,j|+'8   +jG<> Bx @ @~ B6'O1V+'? +'M   'O,jm,jG  D~ D   B6'O1V+'G +'M   'O,jm,jG ~ B8 ~  D~+'C  >~+k!<<s ,jI  +k! ,jI  +k!> Bx @ @~ B6'k1V+'[ +'i   'k,jm,jG  D~ D   B6'k1V+'c +'i   'k,jm,jG ~ B8 ~  D~+'_  >~+k!<<> Bx  D  's,j<    's>+jf<<z,>   
     'z>+jf<> Bx   D   F  ,j< (,j|  (>~+jm<<M    ( +k
<X
(	<@<a<@> Bx   D   F6(&0V+(  B~  F+(  B~ (*,jm B~ ~ (*,jm B} ~ (),j<  } ~ (),jn B~ 
9 ((,jm,jG ((,j< (',j|,jG  ,jI ~,j| ~,j| ,j| ('>}+j|<<|<F
(<q<
<z<{   %w: %p%ned Stub %w called with arguments:..> Bx D F  (V,kB   
 L~6(S0V+(9 ~ +(:  B} 
 L~6(T0V+(> ~ +(?   } B} D|6(S0V+(D6(T1V+(E +(R | } (U,kB ~  B~6(T0V+(K +(K  B| ~  D~6(U0V+(P +(P  B} | B|+(A>{+kO<~<~<<
(*
(,
(W<@<
(X<
(Y<<@> Bx  D (d,j<  (c,jm,jG (c,j< (b>+j|<F
(V<<z    ,~,>   
6(p0V+(n+(n(q>+jf<<+({ ~+)3@}+( ,jG } B  D}+) ,jG  D} D~ ,ji B+(w>},~> Bx   D   F  ),j<   )

9 L  x,m Bx+)-4kP x>,~> Bx D6*0V+))  B6*1V+)! +)" 
92B+)% 
96*1V+)% 3B+)' +)( 
93B+)* x+* x  B6*1V+). +). 
93B+)3  3B*"+)2 +)3 
93B+)_ @ @~ @~ x    F6*1V+): +)G  B},),jG  H~ H~   B6*1V+)B ~+)G  B} ,),jG ~ B8 ~  D~+)> x   ,j| *",j| B @~ @~ @} x  D~6*1V+)Q +)^  B} ,),jG  F} F~ ~  B~6*1V+)Y ~+)^  B} ,),jG } B8 }  D}+)U +* 
x6* 1V+)b x+* x ,k B *! x ,kv   B~ D~3D+)l   x 
>{+k B}6*1V+)o +)p 
93B+)t } 3B*!+)t +)t 
93B+)v x+* ~ B}6*1V+)z +)z 
93B+) } 3B* +)~ +) 
93B+*3@+*  x ,k3B+*  B ~  x 
>{+k@}@}@|)xjD}6*1V+* B}6*1V+* }+*  B| ,),jG | B8 |  D|+* x >{+j|>{,~<<<<<0<<<<~> Bx D @~ @~  F6*V1V+*) +*U  B} @| @| B}6*W1V+*. +*: ,m,jG  H| H| }  B}6*W1V+*5 |+*:  ,m,jG | B8 |  D|+*1,jG  H~ H~   B6*W1V+*@ ~+*U  B} @| @| B}6*W1V+*E +*Q  ,m,jG  D| D| }  B}6*W1V+*L |+*Q  ,m,jG | B8 |  D|+*H,jG ~ B8 ~  D~+*< *W>{+j|<<<> Bx D @~ @~   F6*n1V+* +*k ,m,jG  H~ H~   B6*o1V+*f ~+*k  ,m,jG ~ B8 ~  D~+*b x  ,j| *o>}+j|<<<> Bx D @~ @~   F6+1V+*w ++ ,m,jG  H~ H~   B6+1V+*~ ~++  ,m,jG ~ B8 ~  D~+*z x  ,j| +>}+j|<<<~> Bx D @~ @~  F6+1V++ ++ ,m,jG  H~ H~   B6+1V++ ~++  ,m,jG ~ B8 ~  D~++ x >}+j|<<6+!1V++  +"+kh +mH<<... Leaving macroexpand loop.expandPANEntering macroexpand loop (atomic input forces exit) %w...OPLO[reading with %w]nd> +R,kj Bx2@	++K "3B++7 +R  +Q,jm B +Q +Q,jm B +P +Q,jm B~3@"++C6+M0V++C 
+R3L"++C " +P,j>++C +O  +O,j>  +Q,jm 
 +N ~  ,k? +N,j| x,kk +M>~+kW<"
+"<
+&
+'
+.
+/
+<<{<`<Z$+kE,~Z$+kDZ$+kDZ$@+kE,>+`,jmx+>+jf<^<],>+f,jmx+f>+jf<^<^,>+m,jmx+l>+jf<^<o,>+s,jmx+s>+jf<^<p,>+z,jmx+y>+jf<^<p,>,,jmx,>+jf<^<q,>,,jmx,>+jf<^<d,>,x  ,G>+jf<<o,>   ,N,jm x  ,N>+jf<<p,>   ,U,jm x  ,T>+jf<<p,>   ,[,jm x  ,[>+jf<<q,>   ,b,jm x  ,a>+jf<<d,>   ,h,jm x  ,h>+jf<<j,>   ,o,jm x  ,n>+jf<<g,>   ,u,jm x  ,u>+jf<<m,>   ,|,jm x  ,{>+jf<<e,>   -,jm x  ->+jf<<k,>   -	,jm x  ->+jf<<h,>   -,jm x  ->+jf<<n,>  -,j< x  ->+jf<^</,>   -,jm x  ->+jf<^<-<W<@
- 
-!
-"
-#
-$
-%<
-&
-'
-(<<
-)
-*< <
-+<@<<@<
-&
-,
--<<
-.
-/<<<
-0
-1
-2<<
-3
-4< <@<
-0
-5
-6<<
-7
-8<
-9
-:
-;<<
-<<@<<@<
-9
-=
-><.<<
-9
-?
-@<
-9
-A
-B<
-9
-C
-D<
-9
-E
-F<
-G
-H
-I<<@<
-J
-K
-L<<@<
-M
-N
-O</<@<
-M
-P
-Q<
-R
-S
-T<<@<
-R
-U
-V<
-W
-X
-Y<<@<
-W
-Z
-[<
-\
-]
-^<<@<
-\
-_
-`<
-\
-a
-b<
-\
-c
-d<-
-\
-e
-f< 
-g
-h
-i<<@< 
-g
-j
-k<!
-g
-l
-m<!
-g
-n
-o<2
-g
-p
-q<	
-r
-s
-t<<@<"
-r
-u
-v<"
-w
-x
-y</<@<#
-w
-z
-{<#
-w
-|
-}<
-~
-
.<<@<c
.
.
.<<@<$
.
.
.<$
.
.
.<?<@<C
.	
.

.<0<@<%
.

.
.<=<@<%
.

.
.<&
.
.
.<><@<&
.
.
.<'
.
.
.<-<@<'
.
.
.<(
.
.
.<(
.
.
.<.<@<)
.
. 
.!<)
.
."
.#<*
.$
.%
.&<<@<*
.$
.'
.(<+
.$
.)
.*<+
.+
.,
.-<<@<,
.+
..
./<,
.0
.1
.2<<@<-
.3
.4
.5<<@<-
.3
.6
.7<.
.3
.8
.9<.
.:
.;
.<<<@</
.:
.=
.></
.:
.?
.@<0
.A
.B
.C<<@<0
.A
.D
.E<1
.A
.F
.G<1
.A
.H
.I<2
.A
.J
.K<2
.L
.M
.N<<@<3
.L
.O
.P<3
.L
.Q
.R<4
.L
.S
.T<4
.L
.U
.V<5
.L
.W
.X<5
.Y
.Z
.[<<@<6
.\
.]
.^<<@<6
.\
._
.`<7
.\
.a
.b<7
.c
.d
.e<<@<8
.c
.f
.g<	
.c
.h
.i<8
.j
.k
.l<.<@<9
.m
.n
.o<><@<9
.m
.p
.q<:
.m
.r
.s<:
.t
.u
.v<<@<;
.t
.w
.x<;
.y
.z
.{<<@<<
.|
.}
.~<<@<<
.
/
/<<@<=
/
/
/<<@<=
/
/
/<<@<>
/
/	
/
<<@<>
/
/

/<@<?
/
/<@<<@<?
/<<@CONCATLTAPNAME=PTASAMEPNAMEPCCRNCCDRCCARCCDDRAMEPCCADRAMEPCCDDDRMEPCCADDRMEPCCDDDDREPCCADDDREPCCDDDDDRPCCADDDDRPCCDDDDDDRCCADDDDDRCCDDDDDDDRLE*CCADDDDDDRLE*CCDDDDDDDDRE*CCADDDDDDDRE*CCDDDDDDDDDR*CCADDDDDDDDR*CCDDDDDDDDDDRCCADDDDDDDDDRCCDDDDDDDDDDDRCCADDDDDDDDDDRCCDDDDDDDDDDDDR*CCADDDDDDDDDDDR*CCDDDDDDDDDDDDDRCCADDDDDDDDDDDDRCCDDDDDDDDDDDDDDRCCADDDDDDDDDDDDDRCCDDDDDDDDDDDDDDDRCCADDDDDDDDDDDDDDR	CCDDDDDDDDDDDDDDDDR	CCADDDDDDDDDDDDDDDRFRMDDEFMCROSRCH-CODEFMCROOPTIONO&AUX&OPTIONAL&RESTDEFMACROOPTLISTPILICACA**DEFMACROARG**PILICOMPILE
DEFMACRO-FOR-COMPILINGKSDEFUNSRCHDEFUNOPTION-KE&KEYCCCADEFUN-OPT-LISTCCA*DEFUNARG*TMNEWDEFUNDEFUNBODY	LAMBDA-LIST-KEYWORDSo re&ALLOW-OTHER-KEYSDS&SPECIALH&QUOTELH&EVALLH&LOCALLH&FUNCTIONAL-KE&LIST-OFA&BODYOFAPACKAGECHARACTER* 0
,k+lQ<] 601V+0 +0 
93B+0 
9601V+0 3B+0 +nc,~<<,~600V+0 ,~ ,~<60!0V+0  ,~ ,~<,nd+nd,nd+nd,ne+nd,ne+nd,nf+nd,nf+nd,ng+nd,ng+nd,ng+ne,ng+ne,ng+nf,ng+nf,ng+ng,ng+ng,ng+nh,ng+nh,ng+ni,ng+ni,ng+nj,ng+nj,ng+nk,ng+nk,ng+nl,ng+nl,ng+nm,ng+nm,ng+nn,ng+nn,ng+no,ng+no<~
0P
0Q
0R<<@
0S<@<
0T
0U
0V
0W
0X
0Y<@<r
0Q
0Z<@<*
0[<C
0\
0]<@
0^<@<C
0_
0`
0a
0b<@<@<@<B
0Q
0c
0d
0e<@<B
0f<B
0g
0h<@
0i<@<]
0Q<p
0Q> Bx D F2B+0n +1611V+0t 1,j<,nb x,j< >~+j< 1 ,nb3B+0}   x  ,0j B~   x  +1 1 x ,nb3B+1   x >~+nu 1 x ,nb3B+1 1 x >~+k  1,j<   x ,0j B~  1,j<   x ,0j  ~>~+jI>~,~<<"< 
0O<<<<!> Bx D F   B~ D~2@x+1 +1B 1E x ,nb3B+1%   x  >|+nt 
x61C1V+1) x  D~+14 x   D~  1E,j<,nb B} x,jY  H~ ~ } x   ,jn ,j< B  1D,j< B}  1D,j<,nb ~,j< B}3@~+1= ~ ,j<,jG+1>  ,jI },j|  } x +1>|,~<0<<"<!<<{
1J<{
1K<<@<"
1L<<@<<@<)<@> Bx @| @| @| @| 
     D H~ J~ 
| L} 
| L} 
| L| 
| L|-4kN  3 x   ,nt B @{ @z B{631V+1a +1m  ,jG  Dz D{ {  B{631V+1h {+1m  ,jG z B8 z  Dz+1d B~ @{ @z 
 L{631V+1r +2
 { 630V+1v  +1y3@+1y 3 ,j<+1y ,jG  Dz D{ {  B{631V+1 {+2
 630V+2  +23@+2 3 ,j<+2 ,jG z B8 z  Dz+1{ B| x   3,jm B{ @z @z 
 L{631V+2 +2Z {  By 3  ,j<  y    3,jf By y,jZ  D3D+2 
9 3,jf,jG+2  Bx y    3,jm  y    3,jf,jG  x,jI y,j| By y  y    3,jf  
9,jm  y 3,jf,jG  Dz Dz {  B{631V+27 z+2Z  By 3  ,j<  y    3,jf By y,jZ  D3D+2D 
9 3,jf,jG+2D  Bx y    3,jm  y    3,jf,jG  x,jI y,j| By y  y    3,jf  
9,jm  y 3,jf,jG z B8 z  Dz+23 B{3@}+3 x    ~,j< 3,j| Bz @z @y @y 
 Lz631V+2e +2t z  Bx  3,jm,jG  Dy Dy z  Bz631V+2n y+2t  Bx  3,jm,jG y B8 y  Dy+2j z,j|,js  ~ 3 3,jn ~,j< 3,j|  },jm Bz x    
9,j<  z 3,jf,jG+3 x     {,jI ~,j| 3,j| |,j<  3 3,jf  3,jm  3 { 3,jn3@+3  3 3,jf-4kP>x,~<<{<<{<z<
1F<}
1G<z<L<~<<]<<{
1H
1I<<@> Bx D F2B+3" +4	64
1V+3/ 4  ,nb3B+3+ x 4,jm,nb x,j< >|+j<  4,j<,nb x,j< >|+j< 4  ,nb3B+3A 
x64
0V+3A 
x 
064
0V+3A x   ,lN 
42L+3A3x,jW3x,j|,jGnB~4 +4 4 x ,nb3B+3J   x  ,3 B~   x  +4 4 x ,nb3B+3P  4
 x ,nb3B+3w @~ @~ @} x  D~641V+3^ +4	  B}64
1V+3c ,jG }+3e  ,jG } ,j<,jG  F} F~ ~  B~64
1V+3l ~+4	  B}64
1V+3p ,jG }+3s  ,jG } ,j<,jG } B8 }  D}+3h 4  ,nb3B+3~   x ,3 B~  +4  4
,j<   x ,3 B~  4,j<   x ,3  ~>|+jI>|,~<<0<<"< <<
3<	<<
<<<@> Bx D F     B~ D~ F} H} 4s x ,nb3B+4 
4s L x  Dx+4# 4r x ,nb3B+4# 

9 L} x  Dx2@x+4% +4n 4r x ,nb3B+4,   x,ny  >{+jI 
x64o1V+46 x  D~ 4q  ,nb3B+45 ~ 4q,jm,nb+45 ~ B}+4V 
x 
064o0V+4= x   D~ 4q,jm,nb B}+4A x,jW B~ x    D} 4q  ,nb3B+4L 
x 
064o0V+4J x   4q,jm+4N x   +4N  4q,j<,nb B| x,jY  H~ ~ | x   ,jn ,j< B 4q  ,nb3B+4Z +4[  4p,j< B| 4q  ,nb3B+4` }+4d3@}+4b  4q+4c  4p,j<,nb ~,j< B|3@~+4i ~ ,j<,jG+4j  ,jI |,j|  | x +4>{,~<0<<"<
<<<
4<	<{
4x<{
4y<<@<)<@<<@<<@> Bx @| @| @| @| 
     D H~ J~ 
| L} 
| L} 
| L| 
| L|-4kN
  7
 x   ,ny B @{ @z B{66~1V+5 +5>  By ,lN  7	,nb3B+5 y  7	,jm 7,j< 7,j|  7,jm+5! 
y660V+5 y  +5! y3@8+5! 7 y ,j<+5! ,jG  Dz D{ {  B{66~1V+5' {+5>  By ,lN  7	,nb3B+52 y  7	,jm 7,j< 7,j|  7,jm+5: 
y660V+56 y  +5: y3@8+5: 7 y ,j<+5: ,jG z B8 z  Dz+5# B| @{ @z 
 L{661V+5C +5O {  ,jG  Dz D{ {  B{66~1V+5J {+5O  ,jG z B8 z  Dz+5F B~ x   7	,jm B{ @z @z 
 L{671V+5W +6E {  By  ,lN 7	 ,nb3B+5c y   7	,jm 7,j< 7,j|  7,jm+5m 7 y  ,nb3B+5k 7 y   ,j< 7,j|+5q 7 y  ,j<  y    7,jf Bx y,jZ  D3D+5w 
9 7,jf,jG+5w  Bx y    7,jm  y    7,jf,jG  x,jI x,j| Bx y  y    7,jf  
9,jm  x 7,jf,jG  Dz Dz {  B{66~1V+6 z+6E  By  ,lN 7	 ,nb3B+6 y   7	,jm 7,j< 7,j|  7,jm+6% 7 y  ,nb3B+6# 7 y   ,j< 7,j|+6) 7 y  ,j<  y    7,jf Bx y,jZ  D3D+6/ 
9 7,jf,jG+6/  Bx y    7,jm  y    7,jf,jG  x,jI x,j| Bx y  y    7,jf  
9,jm  x 7,jf,jG z B8 z  Dz+6 B{3@}+6m x    ~,j< 7,j| Bz @z @y @y 
 Lz671V+6P +6_ z  Bx  7	,jm,jG  Dy Dy z  Bz66~1V+6Y y+6_  Bx  7	,jm,jG y B8 y  Dy+6U z,j|,js  ~ 7 7,jn ~,j< 7,j|  },jm Bz x    
9,j<  z 7,jf,jG+6o x     {,jI ~,j| 7,j| |,j<  7 7,jf  7,jm  7 { 7,jn3@+6|  7 7,jf-4kP>w,~<<0<{<{<z<
4t<}
4u<~<z<L<~<<]<<r<^<t<
4v<{<
4w<{
7<{<@> Bx 
 
067O1V+7  83@8+7    7U,nb3B+7     ,j< 7T,j|+7M +7N    B3B+7 +7  
92B+7# 
967P1V+7# 2B+7&  82@8+7N @ @ @~    D67P1V+7, +7@  B~ B} ,k3B+71 
9+71 ,jG  F~ F   B67Q1V+77 +7@  B~ B} ,k3B+7< 
9+7< ,jG ~ B8 ~  D~+73  
9,k3B+7D  7T>}+j<   7S,jm B   7S,j<  7R,jm  7R  7Q>}+jn+7N >},~<0<<<<}
7
<~<~<{<
<X<<
7V<
7W<	
7X<
7Y<
7Z<
7[<
7\<
7]<
7^<
7_<
7`<<@*SYM*T**CONSPLISTP*TARGET***T*****P*M*CHAR*PROD*CHARS*S*ANY*PATTERNT*GENERATEWTRANSFORMLOCALLLYIMPORTEWLOCALSLY*PROD*KEYWORDS*MATCH*PATTERNPATTERNDOMAINYWDO-PRODUCTIONYMAPCAR-PRODUCTIONMAPCAN-PRODUCTIONDEFUN-PRODUCTION<
8<
8<<@<
8
8<@
8<@
8
<@<s
8<
8
8<@<]
8<
8
8<@<
8<j
8<
8<<@<
8<
8<]
8	<V
8
8<@
8 <@<
8<
8!<^
8
8

8"<*<@> Bx D F @| @| 
     B~ D~ F} H} J| 
| L| 
| L{6;0V+85 
x3L;&+; x ;&,jm ;%,j< ;%,j|,jG B~+;6;1V+8< x ;&,jm ;%,j< ;$,j|,jG B~+; ,jG ;$,jG B~ ;#,jG x  B{6;1V+8K3@x+8J x ;&,jm ;%,j< ;$,j|  ~,jG B~ 
9 B{+; +; x  Bx6;0V+8T  ;# {,8#  ;",jm  ;",jm+:6;1V+8Y { ;&,jm ;!,j< ;$,j|+: {,j7 B}@@d"p:l" d",j2 B| %,k2B+8e { ;&,jm ;!,j< ;%,j|+: } 
8$;bD;n;4D8l ,k Z$ },jE,l	+8l  B} 
|2L;!+8w3@+8p2B+8q ; +: ;!,j< ; ,j| 
9  ;,jf  ;",jm+: 
|2L;+9j3@+8{2B+9-2@x+8~ 

9 L{ 
9+: 
x6;0V+9 x ,j7@@ B|d"p:l" d"Z$ ,jR3B+9@@ | 
8";bB;n;,jR3B+9 x   +9 | 
8";bB;n;,k Z$ |,jE,l	  ; ;,jf+9& x  ;&,jm ;,j< ;%,j|+9& 
x6;1V+9! x  ;&,jm ;,j< ;$,j|+9&  ; x ,8#  ;,jm  ;",jm  ; ;,jf 
9,jm ;,j< ,j| ;,j|+:2@x+93 

9 L{ ;%,j< ; ,j| 
9  ;,jf+:  ;,jm ;,j< ;,j|,jG Bz 
x6;0V+9T x ,j7@@ B|d"p:l" d"Z$ ,jR3B+9P@@ | 
8";bB;n;,jR3B+9H x   +9M | 
8";bB;n;,k Z$ |,jE,l	  ; ;,jf+9` x  ;&,jm ;,j< ;%,j|+9` 
x6;1V+9[ x  ;&,jm ;,j< ;$,j|+9`  ; x ,8#  ;,jm  ;",jm  ; ;,jf Bz ; },j< ; ,j| 
9  z,jf  z ;,jf+: 
|2L;+:m3@+9m2B+:'2@x+9p 

9 L{ ;+: 
9 ; ;,jf  ;",jm Bz 
9 ; ;,jf  z ;,jf,jG Bz 
x6;0V+: x ,j7@@ B|d"p:l" d"Z$ ,jR3B+:@@ | 
8";bB;n;,jR3B+:	 x   +: | 
8";bB;n;,k Z$ |,jE,l	  ; ;,jf+:" x  ;&,jm ;,j< ;%,j|+:" 
x6;1V+: x  ;&,jm ;,j< ;$,j|+:"  ; x ,8#  ;,jm  ;",jm  ; ;,jf ;,j<  z ;,jf+:2@x+:/ 

9 L{ ;%,j< ; ,j|  ;,jm  ;",jm+:  ;,jm ;!,j< ;,j|  ;,jm  ;",jm ;,j< ;,j|,jG Bz 
x6;0V+:U x ,j7@@ B|d"p:l" d"Z$ ,jR3B+:P@@ | 
8";bB;n;,jR3B+:H x   +:N | 
8";bB;n;,k Z$ |,jE,l	  ; ;,jf+:a x  ;&,jm ;,j< ;%,j|+:a 
x6;1V+:[ x  ;&,jm ;,j< ;$,j|+:a  ; x ,8#  ;,jm  ;",jm  ; ;,jf Bz  
9,jm  ; ;",jf  z,jm  z ;,jf  } ; ,jf+: 
|2L;+:2B+:| x  Bz x  Dx Bz3@+:z ;!  ,j< ; ,j| z   ;,jf+:  ;# ;,jf+:  ;# ;,jf+:   ~,jG6;0V+; x +;  B{+8A2@{+; ; ~,jG3@~+;  ;,jm  ;,jm ~   ;  ;>y+jn 
9>y,~<x<{x<0<F
8<< 
8<V
8	
8
<
8<
8
<V<<r
8
8
8
8<
8<<<
8<
8<
8
8
8<<c<Z
8<{<> Bx D F ,jG B~ x  B~2B;y+;] x  B}2@}+;0 +;r }  B}2B;x+;6 }  D}  +;Y2B;x+;D }  D}  B|  D} B|    ;x,jf  |,jm  ;w,jm  ~,jG }  B}+;[2B;w+;T }  D}  B|  D}  ;v,jm B|  }   ;x,jf  |,jm  ;w,jm  ~,jG }  B}+;[2B;v+;W }  D} +;Z  }  ;x,jf  ~,jG }  B}+;.2B;u+;r x  B}2@}+;b +;r }  B}2B;x+;i }  D}   ;x,jf +;o2B;u+;n }  D}   ;t,jf +;o }  ~,jG }  B}+;` ~ >|,~<<<<r<<]<<]<j<<
;|<
;}<
;~<<@<<@<<@>	 Bx D F ,jG @| @| @| @| @| @| 
    B~ D~ F} H} J| 
| L| 
| L{ 
| L{ 
| Lz 
| Lz 
| Ly 2@8+< +=4     D By2B=@+<#  x =@,jf Bx  =?,j<   =@,jf  x =?,jf  
9,jm  ~,jG  B+< =?,k3B+<=   Bx   D By @x @x @w  Fx6=91V+<- +<;  Bw ,jm,jG  Hw Hx x  Bx6=:1V+<5 x+<;  Bw ,jm,jG w B8 w  Dw+<1 y ,j| Bz+< 
y2L=>+<C   Bx   D B|+< => y,k3B+<I   Bx   D Bz+< 
y2L==+<W ,jG B{3@+<U (  ,k2B+<U   Bx   D  {,jG+<L {  B{+< 
y2L==+<e ,jG B{3@+<c (  ,k2B+<c   Bx   D  {,jG+<Z {  B{+< 
y2L=<+< ,jG Bx   Bx   D  x,jG Bx (  ,k3B+<r x  B}+<x   Bx   D  x,jG Bx+<m  
=<2L8+=
   B ,jG Bx   Bx   D  x,jG Bx (  ,k3B+= x +=
   Bx   D  x,jG Bx+=  B} =;  ,k3B+= ,jG Bx   Bx   D  x,jG+= ,jG Bx3@+= (  ,k3B+=  x x ,;' B|+=%   Bx   D  x,jG Bx+= }  Bx }  D} Bx3@x+< 
9 =; x,o },j< =:,j| |,j< B~  ~,jG }  Bx }  D} Bx+=( 
{ ~   | { z,k? z>v+j|<<<<
;y<<<K<K
;z<
;{<<<f-*VALUE*-*STACK*> Bx   D   F ,j7 =~,jI,l	 B~ ,j7 =~,jI,l	   ~ B~ D} ,; B}   =},jm  ~,jm B| }  }  B|   D}  | ,jI },j| |,j| B| }  }  D} B| ~ =},jm  =|,jm B{ }  }  D} {,j| B{ }  }  D} =|,j|  { ={,jf  ~ ={,jf B{ }  }  B{ },jG  {,jI {,j|  |,jI |,j| ={>z+j|<t<F<<<j<V
=A
=B-*ITER*G-*TARGET*-*VALUE*-*STACK*>	 Bx D F ,j7 >[,jI,l	 B~ ,j7 >Z,jI,l	 B~ ,j7 >Z,jI,l	 B} ,j7 >Y,jI,l	 @| 
  } ~ ~ B} D| F| H{ J{   Bz3B+> +> 
92B+> 
96>T1V+> 3B+>$   Bz   B z B{  },; 
 L| 
| Lz { |,j< Bz z  z  By   Dz By | { >Y,jf Bx { >X,jm  },jm |,jm Bx } >X,jm  >W,jm Bw z  z  Dz w,j| Bw z  z  Dz >W,j|  w >V,jf  } >V,jf |  x >V,jn  x,jm  x >U,jf Bx z  z  x,j|  y,jI y,j| >V,j|  z  >U>w+jn<z<
<u<t<F<<<j<V<r
=
>
>
>,>   
    >a>+><p,>   
    >g>+><q-*TARGET*> Bx   D   F ,j7 ?,jI,l	 B~   B~3B+>t +>t 
92B+>x 
96?+>x 3B+?   ~,j< B~ ~,jG  ,j< ?,j| ,j| ?,j|  ~  ?>}+jn ~,jG B~ ~,jG ,j< ?,j| ,j| ?,j|  ~  ?>}+jn<~<
<<
>g<
?<<@<
?<<@<
?<f
?<
?<
?< <@<K
?<
?<
?<
?<K
?<
?<
? <
?!<<@CONSTRUCT-NEW-IFSYM=NEXT-IF-CLAUSELDIFFELSETHENELSEIFCan't expand IF.> Bx ?r,jG x    B D F~ H~2@~+?7 +?n ?q ~ ,o2B+?= ?q ~ ,o3B+?a ~3@8+?M ~ 83@8+?N ?p ~   ,o2B+?N ?p ~   ,o2B+?N ?q ~   ,o2B+?N ?o@@,k] ~,o B ~ 83@8+?[ ?p ~   ,o3B+?[  ~   ,o ~  ,j|+?] ~  ,jG B,jG  ~,k 
 L~+?5 ?p ~ ,o3B+?5 ~3@8+?h ~,o3B+?i ?o@@,k] ~  
9,j<,jG  ~,k  ~>},~
?,<<< <H<> Bx  B6@1V+?w +@ @  ,o2B+?} @  ,o3B+?~ +@   D+?u>,~<< <3B+@ ,~ 
9,~,>2B+@	 +@2B+@ +@ ,@ x >+j|>,~> Bx     B D @, ,o2B+@ @,  ,o2B+@ @+  ,o3B+@ x>~+o ,j;0B+@$   ,jm  @+>~+jm   ,jm B~   
9,j<  ~ @+>~+jf<< <<	THROW-AWAY-NEXT-FORM#Q#MCOMMONFAST-VECTORPSLCMACRO> Bx   D    F      H~  ,j< @D,j|   @D>~+jf<<^:l" d",~,>,l- x>+l-<(<!<&<!<~
@O<I
@P
@Q
@R<"
@S<)
@T
@U<@<"<@<$<@<N
@QDEFVARSYMBOLPINTEGERPCHARACTERPARRAYPSUBRPFUNCTIONPEQLEQUALPSYMEVAL***FSYMEVAL***FSYMEVALBOUNDPFBOUNDPMACRO-PSPECIAL-FORM-PFSETMAKUNBOUNDFMAKUNBOUNDFUNCALL*LEXPR-FUNCALL***BINDMARK***SYMBOLSVALUESPROGV***DO-LIST***DOLIST***DO-TIMES***DOTIMESMAPLPROG*DECLARELOCALLYTHEGETPRPUTPRREMPRPLISTGET-PNAMEMAKE-SYMBOLINTERNEDPPLUSPODDPEVENP<=>=/=LEFT-EXPAND1+1-INCFDECFLOGIORLOGXORLOGANDLOGNOTASHELTSETELTCOPYSEQENDPLIST-LENGTHNREVERSEVREFVSETNTHCDRCOPYTREEPAIRLISPUTPROPDEFPROPEVAL-WHEN***SELECTQ-ARG***SELECTQEXPAND-SELECTCOMMENTUNSPECIALASSQLASTFLATCEXPLODECTREE-EQUALCOPYLISTCOPYALISTREVAPPENDNRECONCBUTLASTNBUTLASTBUTTAILNSUBSTOUCHINCHUNINCHLOWIADD1IGREATERPILESSPPOSINTPHIGHISUB1ISIZESIDIFFERENCEMAKE-STRINGSUBSTRINGVECTOR-TO-STRINGSTRING-TO-VECTORLIST-TO-STRINGSTRING-TO-LISTSTRING-LENGTHSTRING=CHAR>CHAR<CHAR=INT-CHARCHAR-INTRPLACHARLDBDPB    B+j<<|> Bx   D   F3@+B ,jG,lq6B1V+B  B,jm  B>~+jm  B,jm  B,jm B~    B,jf  ~ B>~+jf<<<<<L    B#+j<<[    B&+j<<\ 3B+B* +B* 
92B+B. 
96B.1V+B. ,~<    B2+j<<_    B5+j<<_    B9+j<<]    B<+j<<Y 6BL1V+B@ +BA 
92B+BL 
96BM1V+BD 2B+BL 
96BM1V+BH 3B+BL 3BBM+BK ,~ 
9,~<<<~    BQ+j<<a    BT+j<<c    BX+j<<<~
BY
BZ
B[<)<@
B\<@<
B]
B^
B_<^
B`
Ba<@
Bb<@<N
Bc<
BZ
Bd<@<M
Be
Bf
BZ%r has no function definition     Bm+jm
BX> Bx   D Bt,jm  Bt>+jm<<> Bx   D B{,jm  B{>+jm<<<
B~<^
B
C
C<,<@<
B
C<@<c
C
C
C<]
B
C<@<{
C<<@> Bx   D C,jm  C,jm,jG B  C C C,jn   C>~+jf<F<H
B|
B}<,<<
C<^
C
C
C<,<@<
C
C<@<c
C
C
C<]
C
C <@<{
C!<<@> Bx   D C0,jm  C0,jm,jG B  C/ C/ C.,jn   C.>~+jf<F<H
C
C<,<<{
C2<{<@> B   Dx    
  C; C:>+jn<}
C1
C<
C=<,
C=<,<@> Bx   D CF,jm CF,j<  CE>+jm<F
C;<,
CH
CI<
CI<,<@> Bx   D CR,jm CQ,j<  CQ>+jm<F
CG<,> Bx   D   F ,C[   CZ>~+jf<,>2@+C] +Ca ,C[  x  Cb>+jf>,~<K    Cf+j<<-
Cl<@
Cm<@
Cn<@<s
Co
Cp<@
Cq<@<.
Cr<
Cs<
Ct</<@<^
Cu<^
Co
Cv<@<.<@
Cw
Cx</<@<
<@<]
Co
Cy<@<]
Cu> Bx   D    F      H~ D ,j< D,j| B~ D ,j< D,j|  ~,jm B~  D,jm D,j< ~,j| D,j| B~ ~ D,j< D,j< D,j|  ~ D D>}+jn<F
Cf<^
Cg<<r
Ch
Ci</
Cj</
Ck
D
D
D<@<s
D <
D!
D"<@<]
D <0<@<0
D#<
D$
D%<@<s<@<^
D > Bx   D   F  DI,jm B~    DI DH,jf B~  83@8+D5    +D5   DH,jm  DG DG,jf B} DF  ,j< DH,j| B} DF ,jI },j| },j| DE,j| ~,j| ~,j| DE>|+j|<<s
D
D<H
D<<<0
DM<@<@<1<@<@<
DN<s<@> Bx   D   F  D~,jm B~ D}  ,j< D},j| B~    D~ D},jf B} D|  ,j< D|,j| B}  83@8+De    +De   D{,jm  } D{,jf B} Dz  ,j< Dz,j|    D},jf B| Dy ,jI |,j| },j| Dy,j| },j| ~,j| ~,j| Dx>|+j|<<s
DI<
DJ<H<<
DK<
DL<1    E+j<<    E+j<<    E+j<<    ,~ 
     E+jf<F,>   
     >,~    E+j<<    E+j<<    E +j<<~    E$+j<<z    E'+j<<F> Dx,j7 B x,j7  >+jT    E0+j<<D    E4+j<<,>,jh3B+E8 +E8 
93B+E= x,j{3B+E< +E= 
9>,~,>6EI1v+EB1V+EB +EC 
93B+EHZ$ x,j{1B+EG +EH 
9>,~<,>6ET1v+EN1V+EN +EN 
93B+ESZ$ x,j{4BER +ES 
9>,~<EW+j<<aE[+j<<  Ee+j<<    Ei+j<<    El+j<<   2@+Eq Eu+j< 2@8+Es Eu+j< Eu +o,<w<	    Ey+j<<   2@+E~  F+jm 2@8+F F+j< F +o,<y<!,>-4kNb    r,jf r x  ,F
-4kP>,~,>-4kNb3D+F   r,jf r x ,F
-4kP>,~    F+j<<x    F+j<<.    F+j<<l    F"+j<<l 
  @@ F& +j}<T 
  @@ F+ +j}<T 
  O@ F/ +j}<S    F3+j<<V    F6+j<<U    F:+j<<R    F=+j<<S,>,jJ,ji @@ x>+jE%r is not null at end of list6FM0V+FI ,~2B+FK 
9,~  FM,j>+j?<
FB    FQ+j<<J    FT+j<<$    FX+j<<M    F[+j<<O  5HF_ ,~ > +F]    Fd+j<<-    Fg+j<<> B   D    Fx        
   Fr>~+jn<> Bx   D    F        H~ G,jm B~  G,jm B} ~ G,jm  } ~ G>}+jn<F<{> Bx   D   F3@+G G,k3B+G ,ju  G,k3B+G  G>~+j< +G G,k3B+G  G>~+j< >~,~<<<<<G<@> Bx   D   F6G(1V+G" ,o9 G*>~+j| G) ,o9 G*,j|  G) G(,jf >~+jm<<~
G<G<<f
G+<*<@> Bx D2B+G0 +GC   B6GD0V+G7  GF,jm   GF+G= GE,k3B+G: 
9+G=  GF,jm   GE,jf x  ,j< B  x ,G- >~+j|>~,~<<Z
G*<<{    ,~> Bx  D GP,jm  GO>+jm<<{> Bx  D GV,jm  GV>+jm<<{    GZ+j<<'    G]+j<<-    Ga+j<<^    Gd+j<<]  5HGh ,~ > +Gf> Bx D6Gt1V+Gn>+jR  ,Gj3B+Gs   x +Gk>,~<> Bx6H0V+H ,jG B x  B  B~6H1V+H ~ 
 L8 +H  ,jG ~ B8   D ~  F~+G|>~,~<<> Bx6H0V+H    ,j<,jG B x  B  B~6H1V+H ~ 
 L8 +H      ,j<,jG ~ B8   D ~  F~+H>~,~<<> Bx6H'1V+H# +H& ,j<  x +H >,~< 6H-1V+H+ ,~  D +H(<6H30V+H26H30V+H2 +H4,~<<> Bx ,j< 
x 
06H;0V+H:  x +H4>,~<0 6HF0V+HF6HG0V+HF  
6HG1V+HD  @+HE  +H@ ,~<<<0> Bx D6HZ0V+HY ,jG B x  Dx B~6HZ0V+HR 
x2L+HS +HY x ,jG ~ B8 x  Dx ~  F~+HO>~,~<<x    H^+j<<%,>   
   3F+Hf    Hh>+jf Hg>+jm<i<3<+<@   3D+Hn  Ho+jm Ho,~
Hh<+,>   
   3F+Hw    Hy>+jf Hy>+jm<-<,<~
I
<~
I<~
I
<~
I~
I<~
I<~
I<~
I<~
I<~
I<~
I<~
I<~
I<~
I<~
I<I
I
I
I
I
I
I
I
I
I 
I
I!
I
I"
I
I#
I$
I%
I$
I&
I$
I'
I$
I(
I
I
I)
I*
I
I+
I
I,<"<@<$
I-
I.<@<)
I/
I0<@<,<@
I1<@
I2<@
I3<@
I4<@
I5<@<,
I6
I7<@
I8<@
I9<@
I:<@<)
I;
I<<@
I=<@
I><@<!<@<J
I?<R
I@<T
IA<H
I<F
I<I
I<K
I<R
IB<,<@<b
I$<S
I$<S
I$<Z
I$<$
I<M
I)<T
I
IC
I
ID
I-<T<@<)
IE
IF<@<~
IG<U
IH<R
II<U
I
I6
IJ<$<@
IK<@
IL<@<V
IM<
IN<T
IO
IP
IQ
IR<@<s
I6
IS<@<R
IT<
I6<R<@STRLENVECLENPUTSTRBYTSTRBYTPUTVECITMVECITMSTRINFISIZEV<~
Ih<~
Ii<~
Ij<~
Ik<~
Il<~
Im<,<@
In
Io
Ip
Iq
Ir
Is
It
Iu
Iv
Iw
Ix
Iy<)<@
Iz<@<+<@
I{<@<)
I|
I}<@<)
I~
I<@<+
I|
J<@<+
I~
J<@<^
In<_
Ip<$
J<_
J<$<@<`
J<`
Iv<a
Ix<,<@
J
I|
J
I~<a
InSYSLISP-SYNTAXDATA-MACHINEXPARSELVECSCANPARERR*RVEC*PARSEWDEC0PARSEWDEC1WDECLARE*COMMA*PARSEWDEC2PARSEWDEC3REMCOM*PREFIXVECT*WCONSTREFORMREFORMLISRPLCDX*CREFREDERREXPANDQ*SYSLISPNOSPREADSYSNAMENMACROSMACROMKSYSFORWCONSTEVALUABLE	CONSTANTINCREMENTFORMKPROGWPLUS2WLESSPWTIMES2WDIFFERENCEWGREATERPMKFOR1MKLISPFORWSTRINGWARRAYWVAR*LVEC*DEFINEBOPDEFINEROPWPUTVWGETVWLEQWGEQWEQWNEQWSHIFTWNOTWXORWORWANDMODWREMAINDERWQUOTIENTWMINUSNARYLOCNEWNAMGETMEMBEGIN1Missing ] in index expression ,>,> 
Jr2Lr+Jo,oU Br  x Jq>+jf Jq>+oU
Je<R<e> Bx D F @~  B~6K1V+Jy +Jy 
93B+J~ ~ 3BK+J} +J~ 
93B+K ,k	+K ,jG B @} @} B~6K1V+K +K   x,oW,jG  D} D} ~  B~6K1V+K }+K   x,oW,jG } B8 }  D}+K
 B~,k	 x,j| ,j| K>|+j|<<f<g> Bx D  B6K.1V+K +K 
93B+K$  3BK/+K# +K$ 
93B+K,   x,oX B     x,oY  +K- x,oX >~+k <<cOnly [] allowed on LHS of WDECLARATION 6KE0V+K8  +jm  6KE1V+K; +K< 
93B+K@ 3BKF+K? +K@ 
93B+KD      +jm KF+oU<<
K/<ROnly [...] is legal INIT in WDECLARE6K\1V+K[  6K]1V+KQ +KQ 
93B+KU 3BK^+KU +KU 
93B+K[  
K^2L8+KZ   +oY K]+oU ,~<<
KG<i<R
MACRO USED AS FUNCTION<{
Kc<i<@> Bx6LN0V+Ki LT ,k3B+Kj x+LM x 
LT2L8+Ko x ,Kd LT+LL x 
LS2L8+Kv x  ,o[  x ,o\ x+LM x 
LS2L8+K} x   ,Kd x 8 8 B8 x+LM x 
LR2L8+L 
x 
06LN1V+L @2@{+L	 LR x  ,kv  D3D+L	 LR>~+jm LQ x  ,kv2B+L x  ,k3B+L LQ,o]+L x+LM +LM 
x6LN1V+LH @ @ @~ x  D~ ,k  F3F+L" 
LP2L+L" ~,o]3B+L"   x 
,k+Ke x ,o[ B6LO1V+L& ~+LL3@|+L. LP ~,kv  D3D+L. D~ x  ~,j< Bx3@{+L1 ~,o]3B+L: LQ ~,kv B3B+L: LO ~,ll3B+L8 ,jG+L8   >~+kt3@{+L= ~,o]3B+LE LR ~,kv B3B+LE   ,k    >~+k  x,o\ x+LM x ,Kd B x ,o[ >~+j|>~,~<<0<~<m<n<
K_<n<o<~<~<<
KbOnly do expected in SysLisp FOR> Bx @ @ @~ @} @} @| @| @{     D{     F~ 
 
06M1v+Lj1V+Lj   ,oa3B+Lk x>y+oa x     D x      F ~  { M#,jf,jG B| ~  D~ {  M",jf B{ ~ 8 81N+L  ~   M",jf B{ 
3LM!+M M!,o],lg B},lg B}@@ { M ,jf Bz } M ,jm  z,jm  M,jm Bz ~   { M,jf  { M#,jf Bz } M ,jm By | },j< y,j| z,j| ,j| z,j| },j|  |,k B| ~ {,j< |>y+ob<0<q<<<r
LU<r<r<s<<
M(Only do expected in SysLisp FOR<@> Bx @~ @|     D|     F~        H 
 
( 
( 
( 
( J  Mb,jf,jG B} ~  D~ 
6M]1V+M=0v+M?  +M@  ,oa B{ ~  D{ 
3LMa+ME Ma,o],lg B} {,jh3B+MI M`+MI M` { |,jf M_,jm  M_,jm Bz { | M^,jf  | Mb,jf Bz } M^,jm,jG z,j| ,j| z,j| },j|  },k B} ~ |,j< }>y+ob<0<<q<
M#<s<r
M$<r<3@|+Md+o`+oe+oe<
Ms<j<@
Mt
Mu
Mv
Mw
Mx
My
Mz
M{
Mt
M|
Mv
M}
Mx
M~
Mz
M
N
N
N
N
N
N<<@<{
N
N<{
N
N<{
N	
N
<{
N
N

N
N
N
N<{
N
N<{
N
N<
N<u<@
N<u<@
N<v<@
N<i<@
N
N<@
N<@
N<@
N<@<e<@<@<v<@
N<@
N
N <@
N!<@
N"<@
N#<@<e
N$<e
N%<e
N&<e
N'<c
N(<c<@<e
N)<e
N*<e
N+<e
N,
Mt
N-
Mv
N-
Mx
N-
Mz
N-
N.
N/
Mt
N0
Mv
N0
Mx
N0
Mz
N0
N1
N/<{
N2<,<@<,
N3<{
N4<i<@<,<@<f<@WDECLARE1EXTERNALGCSTARTINGBITGCBITLENGTHGCFIELDFIELDPUTGCFIELDPUTFIELDSYMFNCPUTSYMFNC
ADDRESSINGUNITSPERITEMPUTMEM	MAKEITEMCONSTRUCTORMKITEMBTRTAGMKBTRIDMKIDFIXNMKFIXNFLTNMKFLTNBIGNMKBIGNMKPAIRVECTMKVECEVECTWRDSMKWRDSSTRMKSTRBYTESMKBYTESHALFWORDSMKHALFWORDSCODEMKCODETAGSTARTINGBITTAGBITLENGTHTAGINFSTARTINGBITINFBITLENGTHINFPUTINFINTINFMKINTPAIRPACKGETLENSIGNEDFIELDSTRBASECHARACTERSPERWORDSTRPACKBYTEPUTBYTEHALFWORDITMHALFWORDPUTHALFWORDITMPUTHALFWORDHALFWORDPACKVECTPACKEVECTPACKEVECITMPUTEVECITMWRDPACKFIXVALPUTFIXVALFLOATBASEFLOATHIGHORDERFLOATLOWORDER
%CODE-NUMBER-OF-ARGUMENTSSYMVALPUTSYMVALLISPVARIDLOCPUTLISPVARSYMNAMPUTSYMNAMSYMPRPPUTSYMPRPBNDSTKIDPUTBNDSTKIDBNDSTKVALPUTBNDSTKVALADJUSTBNDSTKPTROBARRAYHASHTABLEPUTOBARRAYOCCUPIEDSLOT%CHIPMUNK-KLUDGEPUTIDINFIDINFNONASSOCPATEXPORTEDBYTELENPUTSTRINFPUTVECINFVECINFEVECLENPUTPAIRINFEVECINFWRDLENPUTWRDINFPAIRINFHALFWORDLENPUTHALFWORDINFWRDINFPUTEVECINFHALFWORDINFPUTFIXINFCODEINFPUTFLTINFFIXINFPUTBIGINFFLTINFBIGINFBITSPERWORDADDRESSINGUNITSPERFUNCTIONCELLSTACKDIRECTIONPUTWRDLENPUTEVECLENPUTVECLENPUTSTRLENPUTTAGPUTWRDITMWRDITMNEGINTHBYTESHHALFWORDSHWRDSHVECTFORWARDUNBOUNDPOSINTADJUSTSTACKPOINTEROPENFN> Bx   D6P01V+P& +P/   
 
( 
(    x   x  ,os   B+P$>,~<%r is not currently supported*** A value has not been defined for WConst %r,>,>2FPH+PD2DPG+PA PH,kv2B+PA x PG>+kB  PH x>+k  PF,j>>+j?
P1
P4<<i<i
PJ<i
PK<<@<<@ PQ PP   PP+jn<
PH
PI<i
PS<i
PT<<@<<@ 
 
( 
( P[ P[   PZ+k?<
PQ
PR<i
P]<<@   Pd Pd,jfZ(
Z&  Pc+jn<<x
P\<i
Pf<<@     d(pl(p   Pm Pl+jn<x
Pe> Bx   @@ P{,jfZ&	  Pz,jf BZ& x   P{,jf   Pz>+jf<|<{<sZ(	Z&	   Q,jn Q  Q+jf<|< Q+oy<<i
Q<	<@,> Q    Q,jf  x   Q,jf  Q>+jm<<q<r
Q<i
Q<	<@> Bx Q     Q ,jf  x   Q,jf B x,jZ   Q>+jf<	<q<r
Q   Q#+jf<
<i
Q%<<@   Q(+o{
Q$<i
Q*<
<@   Q-+o{
Q)<i
Q/<   Q2+o{
Q.<i
Q4<<@   Q7+o{
Q3<i
Q9<<@   Q<+o{
Q8<i
Q><<@   QA+o{
Q=<i
QC<<@   QF+o{
QB<i
QH<<@   QK+o{
QG<i
QM<<@   QP+o{
QL<i
QR<<@   QU+o{
QQ<i
QW<<@   QZ+o{
QV<i
Q\<<@   Q_+o{
Q[<i
Qa<<@   Qd+o{
Q`<i
Qg<i
Qh<<@<<@ Qm Qm   Ql+jn<
Qe
Qf<i
Qp<i
Qq<<@<<@ Qv Qv   Qu+jn<
Qn
Qo<i
Qy<i
Qz<<@<<@ 
 
( 
( R R   R+k?<
Qw
Qx  ,~  ,~Z",~<i
R	<i
R
<<@<<@   R,jm R R  R+jn<
R
R<<i
R<	<@ R   R+jf<q
R<i
R<<@,>Z& R# R#,jf  x   R#,jf R#  R">+jf<~<q
R<i
R%<	<@,> R.   R.,jf x     R->+jf<<q
R$<i
R0<	<@> Bx R<   R;,jf B x,jZ  x     R;>+jn<<q
R/<i
R=<	<@,> RG   RF,jf x     RF>+jf< <q
R<<i
RH<	<@> Bx RT   RT,jf B x,jZ  x     RS>+jn<!<q
RGO@   RZ,jfZ&  RZ+jf<q<{Z&   R^+jf<qZ&   Ra+jf<q,>Z&    Rj,jf  x   Ri>+jf<x<q> BxZ&    Ru,jf B x,jZ   x   Rt>+jn<x<q,>Z&    R},jf  x   R}>+jf<x<q> BxZ&    S,jf B x,jZ   x   S>+jn<x<qZ&   S
+jf<qZ&   S+jf<x     Z&   S+jn<x<i
S<	<@ S   S+jf<q
SZ&   S+jf<xZ&   S!+jf<xO@   S%+jf<x<i
S&<'<@   S+ S*+jf<x
S%<i
S,<'<@        S2 S2+jn<x
S+<i
S4<'<@   S9,jm  S9+jm
S3<),>   SA,jm x     SA>+jf<(<)<i
SC<*<@   SG SG+jf<x
SB<i
SI<*<@        SO SN+jn<x
SH<i
SP<+<@   SU ST+jf<x
SO<i
SV<+<@        S\ S\+jn<x
SUO@   S`+jf<x     O@   Se+jn<x   Sh+jm<      Sl+jf<	<i
Sn<	<@,>Z& Sz Sy,jf  x    Sy,jf  x   Sy>+jf<q<r
SmArgument mismatch in SMacro expansion>,jc Bx  D6T0V+T T,j?  T T>+jf<< </
SzArgument mismatch in SMacro expansion>,jc  D,jc Bx  D6T0V+T T,j?  T T,jf   T>~+jf<<h< </
T	Argument mismatch in SMacro expansion>,jc Bx  D6T)0V+T% T+,j?  T*,jm@@  T*>+jf<<v<.
T  ,~<^
T3<1
T4<1
T5<2
T6<2
T7<(
T8<3
T9<3
T:<a
T;<<@<i
T<<(
T=<_
T><4
T?<4
T@
TA
TB<)
TC<5
TD<5
TE<6
TF<
TG
TH
TI<)<@<6
TJ<7
TK<7
TL<@
TM<
TN
TO
TP<8<@<8
TQ<9
TR<@<@
TS<
TN
TT
TU<9
TV<:
TW<@<
TX
TY
TZ<:
T[<;
T\<@
T]<
TG
T^
T_<;
T`<<
Ta<@<
TG
Tb
Tc<<<@<=
Td<	
Te
Tf
Tg<=<@<@
Th<
Ti
Tj
Tk<@<@
Tl<>
Tm
Tn
To<@<@
Tp<>
Te
Tq<@<@<?
TePATHNAMEAPATH$EMPTYPEPATH$EXTRACT-DEVPATH$EXTRACT-PATH
PATH$EXTRACT-PATHNAME re
PATH$EXTRACT-FULL-FILENAMEFULLFILENAMEPADEVNPATH$STRING2PATHNAMPATH$EXTRACT-FILE-PARTSMEXTFILEVERSIONRA	PATH$CREATE-PATHNAMETSMTOTAL-COPY-PATPATH$GET-DEVATPATH$GET-PATHNAMEME
PATH$GET-FULLFILENAMESMPATH$GET-FILEIPATH$GET-EXTIPATH$GET-VERSIONNAMPATH$PATH2STRINGNAMPATH$SET-DEVFIPATH$SET-PATHNAMEAM
PATH$SET-FULLFILENAMESMPATH$SET-FILETPATH$SET-EXTTPATH$SET-VERSIONNAMPATH$SHOW-LOGICALAMLOGNAMETRANSICQUAL>   Bx  UA,jm B x U@ U@,jf   U?>+jf<<c
U5<s> Bx,jJ B@@ B  ,jg2B+UK  x,jCZ$,jR3B+UQ  ,jg3B+UN +US @@ x>~+jE ,ji B+UE>~,~> Bx,jJ B@@ B  ,jg2B+U]  x,jCZ$,jR3B+Uc  ,jg3B+Ua +Ue @@ x>~+jE ,ji B+UW>~,~> Bx,jJ   B D@@ B~  ~,jg2B+Uq ~ x,jCZ$,jR3B+Uw  ~,jg3B+Uu  B+Uy ~ B+Uy ~,ji B~+Uk3@+V ,ji B  ,jh   x,jE>~+p: >~,~> Bx,p: B x,p;    B D~ F~2D+V2F+V 
x L VX,jG B} VW,jG B}  VW,j<  } }>|+jf3D+V&2F+V& ,jJ Z",jj B} x,jJ B} ~,jJ Z",jj  },jh  } x,jE B ~ VX,j< B} VW,jG B}  VW,j<  } }>|+jf2D+V;3F+V; ,jJ Z",jj B} x,jJ B} ~,jJ Z",jj  },jh  } x,jE B VX,jG B} ~ VW,j< B}  VW,j<  } }>|+jf3D+VU3F+VU ,jJ B} ~,jJZ$,jj  },jj B} x,jJ B} ~,jJ B| ~,jJ  |,jj Z",jj  },jh  } x,jE B ~ VX,j< B} ~ VW,j< B}  VW,j<  } }>|+jf >|,~<K<H<KQUAL>,p; 
     D F J~  W#,k  H~ ,p= Bx  W",jT2B+W ~,jJ B} x,jJ Z",jj  },jg3B+Vx x,jJ Z",jj B} ~,jJ B} x,jJ Z",jj  },jh  } ~,jE,p= B+Vy 
W" L ~,jJ B} ,jJ B} x,jJ  },jj Z",jj  },jg3B+W ,jJ B} x,jJ  },jj Z",jj B} ~,jJ B} ,jJ B| x,jJ  |,jj Z",jj  },jh  } ~,jE,p= B+W 
W" L+W 
W" L 
W" L  W",j< B} x W!,j< B}  W!,j<  } },jf ~>|+k<M<M<N
VX<K> Bx,jJ B@@ B  ,jg2B+W0  x,jCZ$,jR2B+W0  x,jCZ$,jR3B+W6  ,jg3B+W4 x+W8 @@ x>~+jE ,ji B+W'>~,~
W:
W;<K<@
W<
W=<H<@
W>
W?<K<@
W@
WA<M<@
WB
WC<M<@
WD<@<N<@ WG+p@
W9  WJ,k ,~<K  WN,k ,~<H  WQ,k ,~<K  WU,k ,~<M  WX,k ,~<M  W\,k ,~<N<RY->P-:PAMPL> Bx   B x,p@  F3F+Wk Wz ,jT2B+Wk Wz ,jI B+Wl 
Wz L x,pA B3B+Wv Wz,jT2B+Wv Wy ,jI  Wy,jI  ,jI B x,pA  >~+jI
W\
W]
W^
W_,>  X,k3B+W 
x L x>,~<K,>  X,k3B+X 
x L x>,~<H> Bx D  ,p= B,pB  x,pE ,pB  x,pF ,pC  x,pF >~,~.NCAQUAL> Bx D  X6,k 
 L x X6,k B x,pB3B+X" x,pB  X5,jT3B+X# X5+X& x,pB  X5,jI B~ x,pC3B+X, x,pC  X5,jT3B+X- X5+X/ x,pC  X5,jI  ~,jI  ,jI  B8 >~,~
X
X<K<M.SEQUAL> Bx D  X^,k 
 L x X],k B x,pB B~3@+XD  X],jT3B+XL x,pC3B+XJ x,pC  X],jT3B+XK X]+XM X\+XM  X\,jI B~ x,pC3B+XS x,pC  X],jT3B+XT X]+XW x,pC  X\,jI  ~,jI  ~,jI  B8 >},~
X7
X8<K<M.SEQUAL> Bx D  Y,k 
 L x Y,k B x,pB B~ x,pB3B+Xn x,pB  Y,jT3B+Xs3@+Xq  Y,jT3B+Xr Y+Xv Y+Xv x,pB  Y,jI B~3@+Xz  Y,jT3B+X{ Y+X|  Y,jI  ~,jI  ~,jI  B8 >},~
X^
X_<K<N+pG<9<@<"
Y<I
Y<G
Y	<H
Y
<G
Y	COMPILED-FUNCTION-PMACRO-FUNCTIONSYMBOL-PLIST*SYMBOL-NAME*ROBUST-LEFT-EXPANDdCOPY-SEQNONLISTERRORUXCOPY-TREECOPY-LISTCOPY-ALISTCT*WRITE-CHART*READ-FROM-STRINGdSTRING-READRINREAD-CHARUNREAD-CHARLRPEEK-CHARREAD-LINESTRING-INPUT    Y0+j<<|> Bx   D   F3@+Y8 ,jG,lq6YG1V+Y> ,jG  YI,jm  YI>~+jm ,jG  YI,jm  YI,jm B~    YH,jf  ~ YH>~+jf<<<<<{    YM+j<<[    YP+j<<\ 3B+YT +YT 
92B+YX 
96YX1V+YX ,~<    Y\+j<<_abp+Y_ ,~ 
9,~    Yc+j<<]    Yf+j<<Y 6Yv1V+Yj +Yk 
92B+Yv 
96Yw1V+Yn 2B+Yv 
96Yw1V+Yr 3B+Yv 3BYw+Yu ,~ 
9,~<<<~    Y{+j<<a    Y~+j<<c    Z+j<<<~
Z
Z
Z<)<@
Z<@<
Z
Z
Z	<^
Z

Z<@
Z
<@<N
Z
Z
Z<@<M
Z
Z
Z%r has no function definition     Z+jm
Z> Bx   D Z,jm  Z>+jm<<> Bx   D Z%,jm  Z%>+jm<<<
Z(<^
Z)
Z*
Z+<,<@<
Z)
Z,<@<c
Z-
Z.
Z/<]
Z)
Z0<@<{
Z1<<@> Bx   D Z@,jm  Z?,jm,jG B  Z? Z> Z>,jn   Z=>~+jf<F<H
Z&
Z'<,<<
ZB<^
ZC
ZD
ZE<,<@<
ZC
ZF<@<c
ZG
ZH
ZI<]
ZC
ZJ<@<{
ZK<<@> Bx   D ZZ,jm  ZZ,jm,jG B  ZY ZY ZX,jn   ZX>~+jf<F<H
Z@
ZA<,<<{
Z\<{<@> B   Dx    
  Ze Zd>+jn<}
Z[
Zf
Zg<,
Zg<,<@> Bx   D Zp,jm Zp,j<  Zo>+jm<F
Ze<,
Zr
Zs<
Zs<,<@> Bx   D Z|,jm Z{,j<  Z{>+jm<F
Zq<,> Bx   D   F ,[   [>~+jf<,>2@+[ +[ ,[  x  [
>+jf>,~<K    [+j<<-
[<@
[<@
[<@<s
[
[<@
[<@<.
[<
[<
[</<@<^
[<^
[
[ <@<.<@
[!
["</<@<
<@<]
[
[#<@<]
[> Bx   D    F      H~ [D ,j< [C,j| B~ [C ,j< [B,j|  ~,jm B~  [B,jm [A,j< ~,j| [A,j| B~ ~ [@,j< [@,j< [?,j|  ~ [? [>>}+jn<F
[<^
[<<r
[
[</
[</
[
[G
[H
[I<@<s
[J<
[K
[L<@<]
[J<0<@<0
[M<
[N
[O<@<s<@<^
[J> Bx   D   F  [s,jm B~    [s [r,jf B~  83@8+[_    +[_   [r,jm  [q [q,jf B} [p  ,j< [r,j| B} [p ,jI },j| },j| [o,j| ~,j| ~,j| [o>|+j|<<s
[D
[E<H
[F<<<0
[w<@<@<1<@<@<
[x<s<@> Bx   D   F  \(,jm B~ \'  ,j< \',j| B~    \( \',jf B} \&  ,j< \&,j| B}  83@8+\    +\   \%,jm  } \%,jf B} \$  ,j< \$,j|    \',jf B| \# ,jI |,j| },j| \#,j| },j| ~,j| ~,j| \">|+j|<<s
[s<
[t<H<<
[u<
[v<1    \++j<<    \/+j<<    \2+j<<    ,~ 
     \:+jf<F,>   
     >,~    \C+j<<z    \G+j<<F> Dx,j7 B x,j7  >+jT    \P+j<<D    \S+j<<,>,j{2B+\W x,jh3B+\Y +\Z 
9>,~,>6\e1v+\_1V+\_ +\` 
93B+\dZ$ x,j{5B\d +\d 
9>,~<,>6\p1v+\j1V+\j +\k 
93B+\oZ$ x,j{4B\o +\o 
9>,~<\t+j<<a>BxDF\},jf  \|>~+jm<<a    ]+j<<
  @@ ] +pJ<y   2@+] ]+j< ] +o,<w<	 
  Z& ] +pJ<x   2@+]  ]!+jm ]! +o,<y<!-4kNb2B+]% +]& r,o,-4kP,~,>-4kNb6]50V+]36]51V+]. +]3    r,jf r x  ,]6-4kP>,~<<,>-4kNb6]?0V+]=   r,jf r x ,]6-4kP>,~<    ]B+j<<x    ]F+j<<.    ]I+j<<l    ]M+j<<l 
  @@ ]Q +j}<T 
  @@ ]V +j}<T 
  O@ ]Z +j}<S    ]^+j<<V    ]a+j<<U    ]e+j<<R    ]h+j<<S,>,jJ,ji @@ x>+jE6]s0V+]p ,~2B+]r 
9,~ ]t+pK<<B    ]w+j<<$    ]{+j<<M    ]~+j<<O    ^+j<<H    ^+j<<> B   D    Fx        
   ^>~+jn<> Bx   D    F        H~ ^ ,jm B~  ^ ,jm B} ~ ^ ,jm  } ~ ^ >}+jn<F<{> Bx   D   F3@+^/ ^6,k3B+^) ,ju  ^5,k3B+^.  ^5>~+j< +^3 ^4,k3B+^3  ^5>~+j< >~,~<<<<<G<@> Bx   D   F6^F1V+^@ ,^K ^H>~+j| ^G ,^K ^H,j|  ^G ^F,jf >~+jm<<~
^6<G<<@<@<f
^J<*<@> Bx D2B+^O +^m    B D~6^n0V+^V2@+^V  B 

9 L~2@~+^\6^n0V+^\  ^q,jm   ^p+^c2@~+^` ^p,k3B+^` 
9+^c  ^q,jm   ^o,jf B~  x  3D+^h +^h ^o ~,j| B~  x ,^K ~>}+j|>},~<
^H<Z
^I<<{    ,~> Bx  D ^z,jm  ^z>+jm<<{> Bx  D _,jm  _>+jm<<{    _+j<<'    _+j<<-    _+j<<^    _+j<<]  5H_ ,~ > +_> Bx D6_1V+_>+jR  ,_3B+_   x +_>,~<> Bx6_10V+_0 ,jG B x  B  B~6_21V+_* ~ 
 L8 +_0  ,jG ~ B8   D ~  F~+_&>~,~<<> Bx6_I0V+_H    ,j<,jG B x  B  B~6_I1V+_? ~ 
 L8 +_H      ,j<,jG ~ B8   D ~  F~+_;>~,~<<> Bx6_R1V+_N +_Q ,j<  x +_K>,~< 6_X1V+_V ,~  D +_S<6__0V+_^6__1V+_] ,~ ,_`+k,~<<> Bx ,j< 
x 
06_g0V+_f  x +_`>,~<0 6_s0V+_s6_t1V+_m ,~  
6_t1V+_q  @+_r  +_m ,~<<<0> Bx D6`0V+` ,jG B x  Dx B~6`0V+_ 
x2L+` +` x ,jG ~ B8 x  Dx ~  F~+_|>~,~<<x    `+j<<%,>   
   3F+`    `>+jf `>+jm<i<3     `+jm<]<+<@   3D+`  ` +jm ` ,~
`<+> Bx   D   F3F+`)    `,,jf+`* `,,jm >~,~<-<, +l> Bx@@Z",k;@@@@ B D x,l B~1B+`7 +`7 
92B+`> 
9 
~1L2B+`> 
9 
0l+`> 3B+`@ +`C ~  ,n>:+`3 @@ >~+oH> Bx  @@ B D F~ ,o33B+`M +`^  ,o33B+`Q >}+ji 
2L~+`V@@ ,jg3B+`V +`^ ~  B~    B}Z$ ,jj B } B ~ B~+`J>},~<~
`o<~
`p<~
`q<~
`r<~
`s<~
`t<~
`u<~
`v<~
`w<~
`x<~
`y<~
`z<~
`{<~
`|<~
`}<I
`~
`
a
a
a
a
a
a
a
a
a
a
a
a
a
a	
a

a	
a
a	
a

a	
a
a
a
a
a
a
a
a
a<"
a<$
a
a<@<)
a
a<@<,<@
a<@
a<@
a<@
a<@
a<@<,
a
a<@
a<@
a<@
a <@<)
a!
a"<@
a#<@
a$<@<_<@<!<@<J
a%<R
a&<T
a'<H
a<F
a<I
a<K
a<R
a(<,<@<b
a	<S
a	<S
a	<Z
a	<$
a<M
a<T
a
a)
a
a*
a<T<@<)
a+
a,<@<~
a-<U
a.<R
a/<U
a
a
a0<$<@
a1<@
a2<@<V
a3<
a4<T
a5
a6
a7
a8<@<s
a
a9<@<R
a:<
a<R<@
WITH-INPUT-FROM-STRINGSICHANNEL-STRING-POSCHANNEL-STRINGSTRING-READCHARION*WITH-INPUT-FROM-TERMINATED-STRING
STRING-READCHAR-TERMINATEDSTRSTRING-READTOKENERMPEN> Dx@@  aa aa a`-4kN(` a00/ a` a_,l  B x 
,k B ,l# -4kP>~,~
aO<1<a<|<sPEN> Dx@@  at as as-4kN(` a00/ ar ar,l  B x 
,k B ,l# -4kP>~,~
ab<1<b<|<s av+pS<> ax+pS<<> p,jJ  p,jg3B+a~ P+b p p,jC Bx p,ji Bp x>,~> p,jJ  p,jg2B+b
 p p,jC Bx p,ji Bp x+b p,jJ,ji  p,jR3B+bZ" Bx p,ji Bp x+b P>,~USERMODEhDOITNPARMAXChNPARMAXLhQUICKIOhSTRINGShGSORTShGET-COMMAND-ARGS0?!FILE-PRIMITIVES0?!D20FORPARD20FORSUPD20FORLEXD20FORPSPD20FORIOD20FORASSD20FORARTD20EXPGRMD20FORPXAD20FORPXBD20FORPXCD20FORPXDD20FORPXED20FORPXFD20FORPXGD20FORPXID20FORPXLD20FORPXND20FORPXOD20FORPXPD20FORPXRD20FORPXSD20FORPXTD20FORPXUD20FORPXWD20FORLABD20FORTMTD20FORTM1D20FORTM2D20FORTM3D20FORTM4VAXFOROUTPXLOADUTD20FORDRVILINPARSE*TREETmaD20FOR$END-OF-INPUT-LINEOLD-POSGVAXFOR$OUT-BUFFER-LENGTHOLD-MARKR	D20FOR$CURRENT-MARKSUCCESS$FPRINTERRINSUCCESS$FMATCHERUT--->I-FAIL-GENDEFUN-FMATCHER
D20FOR$GENERATE-PRINT-LISTn CHECKENDOFLINEFORMAT*URABORT$FMATCHERFMATCHER$MIGNORE*MIGNORE*EFMATCHER$MSELECT*MSELECT*EFMATCHER$MREPEAT*MFMATCHER$MSLOT*MKSLOT*RKEFMATCHER$MOPT*MMKFMATCHER$MIDMNFMATCHER$MSTRINGMKPRINT-AS*CURRENTFFPRINTER$ABORTFPRINTER$MIGNORE*MIFPRINTER$MSELECT*MIFPRINTER$MREPEAT*MIFPRINTER$MSLOT*MTRIFPRINTER$MOPT*MSTRI
FPRINTER$OUTPUT-STRINGHFPRINTER$MIDMNFPRINTER$MSTRINGMLEFPRINTER$DEBUG
cK<@<
cL<y<@-DEFAULT-PRINT-PRINTNG
cM<@<
cN
cO<@<{
cP<
cQ<{
cR<z<@<
cS<z<@***** defun-Fmatcher: Unknown internal state %p ignored.%n<f
cT<
cU***** defun-Fmatcher: Unknown keyword: %p ignored.%n<f
cV<{
cW<{
cX<|
cY<|
cZ<{
c[<}<@
c3<@<}<@
cO
c8<~<@<f<@<<@<{<@<{<@<|<@<|<@<~<@> Bx     B D @| 
     B~ D~ F} H} J| 
| L| 
6e`0V+cl 
 
( J|   B  
er2L8+cp 

9 L|   B  
 L{6e`0V+cu { +cu    eq B{ Dz Fz Hy6e`1V+d3@}+d y  z ,j<  },jG+dE y  z ,j<  ,jG B}+dE 
z2Leq+d
 eq {,k3B+d
 
{ Lz+d? { ep+d? 
z2Lep+d& eo {,k3B+d3@}+d y  z ,j<  },jG+d y  z ,j<  ,jG B}  Bz  Dy 
{ Lz+d? 
{2Leo+d  
{ Lz+d?3@z+d# { z,jG+d? { ,jG Bz+d? en z,k3B+d> eo {,k2B+d03@y+d. { y,jG+d? { ,jG By+d?3@}+d6 y  z ,j<  },jG+d: y  z ,j<  ,jG B}  Bz  Dy 
{ Lz+d? z en,kB {  B{6ea0V+dC +dD  B{+cy  }  B{6ea0V+dI +dJ  B{6e`1V+dM +dV {2@8+dQ2@}+dQ {  B} {  B{6ea0V+dU +dU  B{+dJ  }  B{6ea0V+d[ +d[    B{ Dz Fz6e`1V+d` z+e {3@8+e3@z+d| {  em,jm  em,jm,jG By3@|+di el+dj 
9  el ek,jf By {3@8+do { +dp ek ej,j|  ej ei,jf ei,j< eh,j| y,j| eh,j|  y eg,jf,jG z B8 z  Bz+e {  em,jm  em,jm,jG By3@|+e el+e 
9  el ek,jf By {3@8+e	 { +e	 ek ej,j|  ej ei,jf ei,j< eh,j| y,j| eh,j|  y eg,jf,jG Bz Bz {  B{6ea0V+e +e  B{+d^ B~  }  B{6ea0V+e +e    B{ Dz Fz6e`1V+e$ z+e? {3@8+e93@z+e1 {  eg,jm By 
9 ef ei,jf  eh y eh,jn,jG z B8 z  Bz+e9 {  eg,jm By 
9 ef ei,jf  eh y eh,jn,jG Bz Bz {  B{6ea0V+e= +e>  B{+e! B~3@}+eA }+eB ef ee,j|  ~,jI ej,j| ee,j|  ed eg,jf  |  ed,jn B{ ,j7 ec,jI,l	 B{3@}+eS ,j7 ec,jI,l	 eb,j<+eT   eb,jm  ~,jI ef,j| ee,j|  ea eg,jf  eb { ed,jn  { ej>x+jf<0<{<
c,
c-
c.
c/
c1<

c2<y
c3
c4
c5<<F<H<
c6<w
c7<
c8<
c9
c:<z<
c;
cB<~
cC<
cD
cJ<{<<{
e|
e}<@***** Unknown Fmatcher pattern: %p.%n s<z
e~<<@
e<@<<@<]
f<|<@<|
f<z<@<|<@> Bx   B  g,jm  g,jm g,j< B  
 L~6g	0V+f ~ +f    
9 B~ D} F} H|6g	1V+f }+g6g	0V+f g ~ ,k2B+f~3@|+fM6g	0V+f ~ 
g2L8+fg~jgjB~6g	0V+f$ g ~,j< g,j|+fI6g	0V+f) ~ g,jm g,j< g,j|+fI6g	0V+fG ~  B|2Bg+f1 ~ g,jm g,j< g,j|+fI2Bg+f6 ~ g,jm g,j< g,j|+fI2Bg+f; ~ g,jm g,j< g,j|+fI2Bg+f@ ~ g,jm g,j< g,j|+fI2Bg
,kB+fI ~ g
,kB ,jG | B8 |  B|+f~6g	0V+fR ~ 
g2L8+fRg~jgjB~6g	0V+fW g ~,j< g,j|+f|6g	0V+f\ ~ g,jm g,j< g,j|+f|6g	0V+fz ~  B|2Bg+fd ~ g,jm g,j< g,j|+f|2Bg+fi ~ g,jm g,j< g,j|+f|2Bg+fn ~ g,jm g,j< g,j|+f|2Bg+fs ~ g,jm g,j< g,j|+f|2Bg
,kB+f| ~ g
,kB ,jG B| B} ~  B~6g
0V+g +g  B~+f g
,jI ,j| g,j|  g g
>{+jf<~<~<<y
er<F
es
et<<<<<<=<<<<><<{<
ey<
ez
e{<z<V
g#
g$***** Unknown FPrinter pattern: %p.%n s<{
g%<
g&<{
g'<{
g(<
g)<r
g%<{
g*<{
g+
g,
g-<y<@<
g.<
g%<<@
g/
g0<<@<{<@<y
g%
g&<@
g1<@<
g2
g<@<]
g%<y
g3
g4<@<^
g%> Bx   B  i i,jf  i i i,jn B  
 L~6i0V+gA ~ +gB     B~ D} F} H|6i1V+gH }+h|3@|+h!6i0V+gS ~ 
i2L8+gQ ~    B} ~   D~+gR 
~ L}+gT 
~ L}6i0V+g[ 
}ji i ~ i,k? i,j< i,j|+h6i0V+gb ~ i,jm i,j< i,j| i,j< i,j|+h6i0V+h ~  B|2Bi+gi ~   i,jm+h2Bi+gs ~ i,jm i,j< i,j|  i i
9i i
,jn+h2Bi
+g| ~ i,jm i,j< i,j|  i i
9i i
,jn+h2Bi+h ~ i,jm i
,j< i
,j|  i i
9i i
,jn+h2Bi	+h ~  i,jm i
,j< i	,j|  i i
9i i
,jn+h2Bi+h ~ i,jm i
,j< i,j|  i i
9i i
,jn+h ~ i,kB+h ~ i,kB ,jG | B8 |  B|+hw6i0V+h+ ~ 
i2L8+h) ~    B} ~   D~+h* 
~ L}+h, 
~ L}6i0V+h3 
}ji i ~ i,k? i,j< i,j|+hu6i0V+h: ~ i,jm i,j< i,j| i,j< i,j|+hu6i0V+hs ~  B|2Bi+hA ~   i,jm+hu2Bi+hK ~ i,jm i,j< i,j|  i i
9i i
,jn+hu2Bi
+hT ~ i,jm i,j< i,j|  i i
9i i
,jn+hu2Bi+h^ ~ i,jm i
,j< i
,j|  i i
9i i
,jn+hu2Bi	+hh ~  i,jm i
,j< i	,j|  i i
9i i
,jn+hu2Bi+hq ~ i,jm i
,j< i,j|  i i
9i i
,jn+hu ~ i,kB+hu ~ i,kB ,jG B| B} ~  D~6i0V+h{ +h{  B~+gE B~ 
9,jG  ~,jI i,j| i,j|   i i>{+jn<~<~<<y<_
g
g<<<	<<	
g<=<
<<
g<<y<

g<><<<
g<{
g <
<{<<<H
g!<<w
g"<
<@FMATCHER$STRINGARK
D20FOR$NEXT-INPUT-CHARpaFMATCHER$DEBUGMOMMYER$D
D20FOR$DO-FMATCH-LISTnVAXFOR$OUT-BUFFERLE	D20FOR$DO-PRINT-LISTGTH	matched %p and %p%nboged out on %p and %p%n> Bx @@ B D x 
8$iUbDiVniV ,jg2B+iH,p~ B~  xd"p:l" d"  ~ B,jR2B+iG 
iX2L+iF  xd"p:l" d"   iW,kW 
9+iG 3B+iL x 
8$iUbDiVniV >~+jg 
iX2L+iS  xd"p:l" d"   iW,kW ,ji B+i3x
i*
i,<	String Failed: %p%n	String Matched: %p%np%n> Bx D F,p~3B+ih x,l	  ,jG3@+ig x ip,kW  +in3@+ik x ip,kW 
 L
 io io>~+kh>~,~<<~
iX
i[
Function Failed: %w%nn
Function Matched: %w%nn> Bx D F  x 
,k 3Hj
+j  ,jG3@+j x j
,kW  +j3@+j x j	,kW 
 L
 j
 j	>~+kh>~,~<
iq
it<~Opt* Failed: %p%nOpt* Matched: %p%n> Bx D F 
   D~ F} ,q  H~3Hj3+j+ 

 L  B} H}6j00V+j  +j  B|6j11V+j  +j' | ,jG }  B}6j10V+j& +j&  B|+j3@+j* ~ j2,kW  +j/3@+j.  j2,kW 
} L
 j3>|,~<<}<
j
j~Slot* Failed: %p%n	Slot* Matched: %p%n> Dx   ,q  H3HjJ+jC  x,jG3@+jB  jI,kW x +jH3@+jF  jI,kW  x>+jG>,~
j3
j6<~
Repeat* Succeeded %p%nn> Bx D F   B~ x ,q B~2Bjp+jU +jh3@+jX  jp,kW 

9 L~ 

 L  
~ L}6jn0V+j^ } +j_  B}6jn0V+jQ } ,jG }  B}6jo0V+jf +jg  B}+j_ 
 L
3@~+jk  +jm jp jo>|+kh>|,~<}<<
jJ<~
Select* Succeeded %p%nn	Select* Failed %p%n> Bx D F    B~ D~ F}3@~+k ~  B} ~  D~,jG,q B~3Bk"+j|  
~2Lk"+k
3@+k x  k!,kW 
 L
 k" k!>|+kh3@+k

 L  B} 
~ L}6k0V+k } +k  B|6k1V+k +k | ,jG }  B}6k 0V+k +k  B|+k  >|,~<}<
jq<
jt<~
Ignore* Succeeded %p%nn> Bx D  

 L x ,q B~2Bk4+k- +k13@+k/  k4,kW 

 L+k) 
 L
  >~,~
k"<~***** Unknown Fmatcher pattern: %p.%n s<<@> Bx l@,kj B2@	+l9 ,jG 
 B D~  B~ 
x L~6l:0V+kF ~ +kF    B} D} F|6l:1V+kK }+l66l;0V+kP l? } ,k2B+l13@|+l6l;0V+kV } 
l?2L8+kV }   B}6l;0V+kZ ~  },pw+k~6l;0V+k^ ~  },pw+k~6l;0V+kd } 
l>2L8+kd ~  },pv+k~6l;0V+kj } 
l>2L8+kj ~  },pu+k~6l;0V+kp } 
l=2L8+kp ~  },pu+k~6l;0V+kv } 
l=2L8+kv ~  },pt+k~6l;0V+k| } 
l<2L8+k| ~  },ps+k~ } l<,kB ,jG | B8 |  B|+l16l;0V+l } 
l?2L8+l }   B}6l;0V+l ~  },pw+l/6l;0V+l ~  },pw+l/6l;0V+l } 
l>2L8+l ~  },pv+l/6l;0V+l } 
l>2L8+l ~  },pu+l/6l;0V+l! } 
l=2L8+l! ~  },pu+l/6l;0V+l' } 
l=2L8+l' ~  },pt+l/6l;0V+l- } 
l<2L8+l- ~  },ps+l/ } l<,kB ,jG B| B} ~  B~6l;0V+l5 +l5  B}+kI   B ,kk >|,~<~<}<
k5<<<=<<><
k9<Buffer is >%w<%n-LE> Bx 
$l]bDl^nl^@@ B D  ,jg3B+lK +lV ,ji B  xd"p:l" d"   d"p:l" df ,ji B+lH3@+l\ ,ji @@ ,jE  l_,kW 
9>~,~x
l@
String Printed (%w)%nTH> Bx D F H~,l	2B+lk3@+li x lp,kW ~,p| 
9+ln 
 L  lo>~+kh>~,~<
l_Function (%p->%p) >%w<%n-PRINTG> Bx D F,j7 m	,jI,l	   
,k3B+m3@+m ,ji @@ ,jE   x m,kW 
9+m 
 L  m>~+kh>~,~<
lp
ls	Opt* (%p->%p) >%w<%nGTH> Bx F H   B~  x ,q 
 J~3@(+m3@+m ,ji @@ ,jE   x  m,kW ~ +m 
~ L >},~
m	
Slot* (%p->%p) >%w<%nTH> Bx F H   B~  x ,q 
 J~3@(+m33@+m2 ,ji @@ ,jE   x  m6,kW ~ +m5 
~ L >},~
m 	Repeat* (%p) >%w<%n	Repeat* Printed %p%nGTH> Bx D F   B~  x ,q B~2@+mD +mQ3@+mM x  mX,kW ,ji @@ ,jE  x  mW,kW 

9 L~ ~  B 
 L+m@ 
 L3@~+mT +mV  mW>}+kh>},~<
m6
m9
Select* Printed (%w)%nH> Bx D F  x   Hx  B~ ~,jG ,q B~2@+me2@x+mo3@+ml3@+mi x mt,kW ~  B 
 L+mr 
 L  ms>}+kh x  x  Dx B~+ma>},~<
mX> Bx  x  B6n0V+mz +m{  B6n1V+m~ +n x ,l	,p|   B6n0V+n +n  B+m{ 
9>~,~<<***** Unknown FPrinter pattern: %p.%n s	Do-Print-List >%w<%nGTH> Bx D6ns1V+n +nr nz,kj B2@	+nr    B~ D~3@+n ,ji @@ ,jE  ny,kW  B} 
x L}6nt0V+n# } +n$   B} D|6nt1V+n)  
9,j<+np6nt0V+n3 } 
ny2L8+n1 }    B| }   D}+n2 
} L|+n4 
} L|6nt0V+n< | ~ ~ },p}3B+nk   D  F~+nk6nt0V+nC ~ ~ },p|3B+nk   D  F~+nk6nt0V+nh }  B|2Bnx+nJ }  ,p|+nk2Bnx+nO  ~ ~ },p{ B  D~+nk2Bnw+nV3@~+nk  ~ ~ },p{ B  D~+nk2Bnw+n[  ~ },pz B  D~+nk2Bnv+n`  ~ } ,pz B  D~+nk2Bnv+nd },py   B+ng } nu,kB  nz,kh+nk } nu,kB  nz,kh }  B}6nu0V+no +no  B}+n% B~ ,kk ~>{,~<<}<}<
n<<<=<<><<
n
<<<@<{<@<|<@<
<@<<@QUICKIO$PUTCHARio"'	QUICKIO$NEXTTABSTOPQUICKIO$PUTSTRINGP	QUICKIO$PUTENDOFLINEload        o+jf<3<@>   Bx o,j< o,j| Z$ o,jf  xZ$ o,jn  x o>+jf<<<<

o<$<@<@>      Bx D o7,jm o6,j<@@,j| o6,j| o5,j| B o5 ,j< o4,j|  x o4,jf  o3,jm   o3>~+jf<u<r<<N
o<M<$
o<U    o:+jm<
FILE-ATTRIBUTE-COLLECTreFILE-ATTR-PUSHBACK	FILE-ATTRIBUTE-READCON$ERROR-MESSAGEDFILE-ATTR-INVALEADFATALROR-FILE-ATTR-EOFBDEFAULT-AND-CHECK-PARMSnINFORMATIONSSAWARNINGR-DEFAULT-AND-CHECK-PARMS-BOGUSALWAYSTPaCON$PROCESS-PARAMS%STATUSTIOUNKNATTR-Unknown attribute (%p) in file %p..CON> Bx D,k'2B+oh p! x,jI Bx,k'3B+p  B" p  x,l B| 
     B D~ F~ H} J} 
| L| p ,kj B|2@	+p  |,q B} ,k2B+o} x } p,j>  p p,q  p ,kh  B~ p |,q  B},k2B+p ~ },j< B~+o~ 
} L"3@~+p
 ~,k	 
9,j| },j| ,j< B+ot  },jm ,j< B+ot B~ |,l# 
~2Lp+p3@~+p ~,k	 
9,j| },j| ,j< B+p  },jm >{+j< ~+p >{,~<<
o[
o\<<2
o`,>2@"+p',m42BP+p( x p)>+kh "  F">,~<DFLTVLSPDRequired attribute %w supplied default value %p.PROCTERM-
Processing terminated.d.CALLRINFO%wMSATTRREQD-
Attribute %w is required.er vIMPRPRVALAttribute %w has an improper value: %p.> Bx D q),kj B2@	+q!  B~ 
 L~6q"0V+pL ~ +pM    B~ D} F}6q"1V+pR }+q x ~ ,k B}3B+pu 2@8+pZ ~ ,jG },j< B}+qZ$ ~,k3B+p_ }  +pa }    B| ~,jZ  | 
,k3B+poZ$ ~,k3B+pj }  +pl }    ~ ,j| },j< B}+q }   ~  q),j>  q( q(,q+q ~ 83@8+q ~  q',j>  q' q(,qZ$ ~,k3B+qZ$ ~,k  q&,j>  q& q%,qZ$ ~,k3B+q
 q%,j>  q$ q$,q  q),khZ$ ~,k3B+qZ$ ~,k  ~  q#,j>  q# q%,q ~ 8 82@8+qZ$ ~,k ~ ,j| },j< B} ~  B~6q"0V+q +q  B~+pO B~ ,kk ~>|,~<~<
p*
p+<
p1
p2<
p5
p7
p8
p9<
p=
p>< 
9,~,>,> q4.,k%%x,q3B+q2>+q>,~<]IFOR,>2BqW+qB qW+qK2BqV+qD qV+qK2BqU+qF qU+qK2BqT+qH qT+qK2BqS+qJ qS+qK     qR,kB 
x2LqS+qP qR>+j? >,~
q4
q8
q:<
q;<l
q<<
q=<
q><<<@<9<@<G
q[<G<@STRING-EQUALSTRINGIFYCHAR-EQUALSTRING<STRING>STRING<=STRING>=STRING<>STRING-LESSPCHAR-LESSPSTRING-GREATERP	STRING-NOT-GREATERPSTRING-NOT-LESSPSTRING-LESSP=STRING-NOT-EQUALSTRING-REPEATSTRING-TRIMSTRING-LEFT-TRIMSTRING-RIGHT-TRIMSTRING-UPCASENSTRING-UPCASELOWERCASEPCHAR-UPCASESTRING-DOWNCASENSTRING-DOWNCASEUPPERCASEPCHAR-DOWNCASESTRING-CAPITALIZENSTRING-CAPITALIZESTRING-CONCATCHARS+jD> D,q Bx ,q B3Bx+r" +r# 
92B+r/  
8$r0bDr0nr1: x 
8"r0bBr0nr1: B,jR3B+r/@@   x>~+r1>~,~x> Bx D F H~  ,jR2B+rD ~ xd"p:l" d" B~ ~ d"p:l" d"  ~,q3B+rD ~,ji    x+r2>},~> D,q Bx ,q@@ 
(rPbHrQnrQ: x 
8&rPbFrQnrQ:  x>+rRx> Bx D F H~ J~  ,jR3B+r[ ~ ~,jR2B+rs ~+rt ~ ~,jR2B+rs ~ xd"p:l" d" B} ~ d"p:l" d"2B}+rj ~,ji 
 ~   x+rR ~ xd"p:l" d" B} ~ d"p:l" d"3b}+rs ~+rt >|,~   +q
> D,q Bx ,q@@ 
(sbHsns: x 
8&sbFsns:  x>+sx> Bx D F H~ J~  ,jR3B+s ~+s$ ~ ~,jR2B+s# ~ xd"p:l" d" B} ~ d"p:l" d"2B}+s ~,ji 
~qx+s~qxd"p:l" d" B} ~ d"p:l" d"3b}+s# ~+s$ >|,~   +q
$s:bDs:ns;: x 
8"s:bBs:ns;: B D~,jg2B+s6@@ ~   x+s9@@  ~ x >~+s;x> Bx D F H~ J~  ,jR3B+sE ~ ~,jR3B+sD +sR ~+sS ~ xd"p:l" d" B} ~ d"p:l" d"2B}+sR ~,ji 
 ~   x+s<+sS ~>},~> D,q Bx ,q@@ 
(s_bHs`ns`: x 
8&s_bFs`ns`:  x>+sax> Bx D F H~ J~  ,jR3B+sj ~ ~,jR2B+t ~+t ~ ~,jR2B+t ~ xd"p:l" d" B} ~ d"p:l" d"  },q3B+sz ~,ji 
 ~   x+sa ~ xd"p:l" d" B} ~ d"p:l" d"  },q3B+t ~+t >},~   +q> D,q Bx ,q@@ 
(tbHtnt: x 
8&tbFtnt:  x>+tx> Bx D F H~ J~  ,jR3B+t ~+t9 ~ ~,jR2B+t8 ~ xd"p:l" d" B} ~ d"p:l" d"  },q3B+t- ~,ji 
 ~   x+t ~ xd"p:l" d" B} ~ d"p:l" d"  },q3B+t8 ~+t9 >},~   +q> D,q Bx ,q B 
$tObDtOntP: x 
8"tObBtOntP: B D~,jg2B+tK@@ ~   x+tN@@  ~ x >~+tPx> Bx D F H~ J~  ,jR3B+tZ ~ ~,jR3B+tY +th ~+ti ~ xd"p:l" d" B} ~ d"p:l" d"  },q3B+ti ~,ji 
 ~   x+tQ+ti ~>},~,>,k x>+k;> D,q Bx@@ ,jR3B+tt u+uZ$ ,jR3B+tx x>|+k6 x 
8"ubBunu: B  ,jiZ$>,k; B~O@Z" B~ D}  ~,jg3B+u +u@@ B}  },jR2B+u },ji B} } xd"p:l" d"  } ~d"p:l" df },ji B}+u ~,ji B~+u ~>|,~x
tm> Bx ,q B 
"u/bBu/nu0: B @@  x,u1 B~   x,uA  ~ B~ D}  },jg2B+u* u0+u. }/~> ~ >}+jE>},~x
u> Bx D F H~  ,jR2B+u;  d"p:l" d" x,uQ2B+u< +u@ ,ji ~   x+u1>~,~> Bx D F@@ ,jR2B+uL ,k  d"p:l" d" x,uQ2B+uM +uP ,k   x+uA>~,~6uY0V+uS+k6uY0V+uX 
(uYbHuZnuZ:@@+u[ ,~<x> Bx D F H~  ,j~3B+uj  d"p:l" d"3Bx+ue +uf 
92B+uj ,ji ~   x+u[>~,~> Bx ,q B 
"u}bBu~nu~: B @@  x,u1 B~  ,jg2B+uy u+u| /~> ~ >~+jE>~,~x
uk> Bx ,q B 
&vbFvnv:  x,uA B@@,jg2B+v v+v >@@ >~+jE>~,~x
u,q,k6+q> Bx 
"v*bBv*nv+: B@@ B  ,jR3B+v +v(  xd"p:l" d" B~,q3B+v& ~,q   xd"p:l" df ,ji B+v x>~,~x,q,k6+q> Bx 
"vDbBvEnvE: B@@ B  ,jR3B+v6 +vC  xd"p:l" d" B~,q3B+vA ~,q   xd"p:l" df ,ji B+v3 x>~,~x,q,k6+q> Bx  
"vmbBvnnvn: B D@@ B~  ~,jR3B+vR +vl ~ xd"p:l" d" B~,q3B+v_3@+v^ ~,q  ~ xd"p:l" df+vj 

9 L+vj ~,q3B+vi2@+vj ~,q  ~ xd"p:l" df 

9 L+vj  D ~,ji B~+vN x>},~x%r cannot be coerced to a string6vy1V+vy6vy0V+vw+j7  vz,j>+j?,~<
vo+j<+j7,>,>,q  x>+jE,jJ+ji> Bx  D ,j; B@@,jR3B+w
 w+wZ$ ,jR3B+w   w,jm  w>~+jm  >~+w>~,~<E<
w> Bx DZ$ ,jR3B+w x  w',jm B x   w',jm+w$ x  w',jm B ,k  x ,w   w&>~+jf<X<%r has no function definition<(<@STANDARD-CHARPGRAPHICPSTRING-CHARPALPHAPDIGITPALPHANUMERICPCHAR-GREATERPCHAR-CODECHAR-BITSCHAR-FONTCODE-CHARCHARACTERDIGIT-CHARCHAR-BITS-LIMITCHAR-FONT-LIMITCHAR-CODE-LIMITBOTHCASEP abp+wN +wN 
93B+w` 
91$+wQ 2B+wT 
90d?+wT 3B+wV +wW 
92B+w` 
91D+wZ 2B+w` 
91D+w] 2B+w` 
91D+w` ,~ abp+wc +wd 
93B+wj 
90$+wg 3B+wj 
91$?+wj ,~,>abp+wm +wn 
93B+ww x,jh3B+wr +wr 
93B+wwZ$? x,jg3B+ww +ww 
9>,~,>,q2B+w| x>+q>,~ abp+x +x 
93B+x 
90$ +x 3B+x 
91d-+x ,~ abp+x
 +x 
93B+x 
90$0+x 3B+x 
91d=+x ,~`bp+x1"+x0b+xZ$+jh ,~,>,q2B+x x>+q>,~+jR> Bx D3B+x! +x! 
92B+x: x,q3B+x: ,q3B+x: 
9 
x1,+x) 2B+x, 
9 
x0l+x, 3B+x: 
9 
1,+x0 2B+x3 
9 
0l+x3 3B+x:Z$ x,kD BZ$ ,kD  >~+jR>~,~+j~+jg> Bx D3"+xA +xA 
92B+xZ x,q3B+xZ ,q3B+xZ 
9 
x1,+xI 2B+xL 
9 
x0l+xL 3B+xZ 
9 
1,+xP 2B+xS 
9 
0l+xS 3B+xZZ$ x,kD BZ$ ,kD  >~+j~>~,~> Bx D2b+x_ +x_ 
92B+xx x,q3B+xx ,q3B+xx 
9 
x1,+xg 2B+xj 
9 
x0l+xj 3B+xx 
9 
1,+xn 2B+xq 
9 
0l+xq 3B+xxZ$ x,kD BZ$ ,kD  >~+jg>~,~     ,~    @@,~    @@,~     ,~%r cannot be coerced to a characterabp+y6y0V+y@@:l" d",~6y0V+y,j7@@:l" d",~  y,j>+j?,~<
y1"0+y0b=+yZ$0,jh Z" +jj,~1" +y$0b-+y$Z$ ,jh Z"0+jj,~,>,jh2B+y,Z$ x,jg2B+y, xZ">+jj >,~     ,~     ,~%r has no function definition</<@<0<@<0<@STRINGCOMPAREIDCOMPARESLOWIDSORTINSERTIDNEWNODEVALLNODERNODENEWLEFTNODENEWRIGHTNODEIDSORTIDTREESORTTREE2LSTIDPUTTREEIDPLACETOLEFTGENSORTGENTREESORTGENPUTTREEGTREESORTGSORTFN*GPUTTREEIDSORTFNNUMBERSORTFNNUMBERSORTSTRINGSORTFNSTRINGSORTNOSORTFNATOMSORTFNATOMSORTSTRINGLENGTHFNIDLENGTHFNSC1IDC1SC2IDC2GSORTPGMERGELISTSMIDPOINTGMERGESORTGMERGESORT1> Bx D,jJ B ,jJ B~  ,j B}@@~ } ~,jg3B+z ~ ,j~3B+z
Z"+z ~ ,jg3B+zO@+z@@+z ~ x,jC B} ~ ,jC  },j~3B+zZ"+z ~ x,jC B} ~ ,jC  },jg3B+zO@+z ~,ji B~+z>|,~> Dx,j7 B x,j7  >+q",>2B+z( +z, ,z&  x >+q$>,~,>,>2D+z0>+jG ,q#,jh2B+z5  x>+j<   x,z-  >+j|Argument mismatch in SMacro expansion>,jc Bx  D6zE0V+zC zF,j?   zF>+jf<<z
z9Argument mismatch in SMacro expansion>,jc Bx  D6zS0V+zQ zT,j?  zS>+jm<<]
zGArgument mismatch in SMacro expansion>,jc Bx  D6z`0V+z^ za,j?  za>+jm<<p
zTArgument mismatch in SMacro expansion>,jc Bx  D6zn0V+zl zo,j?  zn>+jm<<q
zbArgument mismatch in SMacro expansion>,jc  D,jc Bx  D6{0V+z{ {,j?  {,jm B~  {,jm  ~ {>~+jf<<^<3<^
zoArgument mismatch in SMacro expansion>,jc  D,jc Bx  D6{0V+{ {,j?  {,jm B~  {,jm  ~ {>~+jf<<_<3<^
{,q( +q(,>,>2B+{ +{$  ,jm B x  Bx6{%0V+{$  ,q)+{ >,~<Argument mismatch in SMacro expansion>,jc  D,jc Bx  D6{60V+{1 {7,j?   {7,jf@@  {6>~+jf<<<2
{&,>,>   x,q#,jh2B+{E  83@8+{A    D+{9  x,jm  8 B8 +{M  83@8+{J    B+{9  x,jm  8 B8 >,~,>,>3@x+{X  x  ,{O x ,j| B x   Dx+{P >,~,q* +q(> Bx D @2B+{` +{h  ,jm B x  Bx6{i0V+{g   ,q++{b >~,~<> Bx D F    x 
,k3B+{xj83@8+{t|D+{lx,jm|8B8+|83@8+{}qB+{lx,jm|8B8>~,~,>,>|	,kx,q+|,q(Bx|	,ltx>,~<;,>,>2B+|8 B8 >,~,q#,jh3B+|/ ,~ 
9,~,jg3B+|3 ,~ 
9,~ |6+pW<<,q",jh3B+|: ,~ 
9,~ |<+pW<= ,~6|W0V+|D6|W0V+|C,q-+|U ,~6|W1V+|F0v+|M6|W0V+|I 
9,~6|W1V+|K0v+|L,q-+|U ,~6|W0V+|V6|W0V+|Q 
9,~6|W1V+|T0v+|U 
9,~+q.,~ ,~<< |Y+pW<?> Dx,jJ B x,jJ  ,jg3B+|a +|a 
9>,~> Dx,j7 B x,j7  >+q1> @x"} B}$}
 D~ 
&}
bF}~ 
(}
bH}3f+|r Hx+|s Fx@@ 
3lx+|x 
~2l+|w 
9+}
 +}
  }:l" d" 
  ~:l" d"2*+} 
9+}
  }:l" d" 
  ~:l" d"3j+}	 +}
:+|s>},~xxx> Dx,j7 B x,j7  >+q2> "}1 B~$}1 DZ$ 
"}2bB}2n}3."& BZ$  
8"}2bB}2n}3."& Bx:~:2"+}" +}# @@3j+}( 
2lx+}' 
9+}0 +}0 .~ . 
3l+}, 
9+}0 
2,+}/ +}0:+}#>~,~xxx> Dx,j7 B x,j7  >+q3,>,>6}I1V+}= 
9+}H 
x6}I1V+}@ 
9+}H  x   x  
,k2B+}F +}H x  Dx+}=>,~<<0> Bx D F6}]1V+}O +}\6}]0V+}\   
,k3B+}W   x ,}J x +}[    x,}J  >~+j|>~,~<<> Bx D F 
x3L+}h@@ ,jg3B+}h x  Dx ,k B+}` x>~,~,>,>,j;    x>+q6> Bx D F H~@@ ,jg2B+}u +~ 
0L+}{ x2@8+}y x+~ x >}+jG 
0L+~ ~ x   x  
,k3B+~ x   x >}+jm x  x  >}+jm @~ @}Z$ ,jj B}   x,q5 B~ ~ }  x,}o Bx } ,jh ~   ~,}o B ~  x>}+q4>},~GET-COMMAND-STRING	PARSE-COMMAND-STRING,q6+q7<F
~!<E<@ ~&,kJZ& ~% ~%+l	<g<{
~ > Bx,jJ@@    B D F~ H~ ~ ~,jg2B+~6 ~ xd"p:l" d"Z$,jR3B+~6 ~,ji B~+~, ~ ~,jg3B+~: +~L 
~ L ~ ,jg2B+~E  xd"p:l" d"Z$,jR2B+~E ,ji B+~; /~> ~ x,jE  ,k  B ,ji B~+~, >},~<"
~N<"<@CHAR-BLANK?COMMAND-STRING*DEC20-GET-COMMAND-STRING
DEC20-READ-PROCESS-ARGJCONVRECOPYSTRINGTONULLJSYS,>Z$,jR2B+~dZ$ x>+jR>,~ V2B+~h,q8 BV,~runTETUR> @ @~,q9 Bx,jJ B,jh3B+~q $+#@@  ,jg2B+~{  xd"p:l" d",q73B+~{ ,ji B+~q 
 L~  ~,jg2B+ ~ xd"p:l" d",q72B+ ~,ji B~+~| ~/>  x,jE $,q
3B+ $+#  ~,jg2B+ ~ xd"p:l" d",q73B+ ~,ji B~+ ~ ,jg3B+  xd"p:l" d",q2B+ ,k B+ ,ji /~> ~ x>~+jE>~,~
~h
~iETUR> @@@Z$ ?2  Bx@@,jg3B+2 x,k; B,q9 x  @2  >~+q:@@   Bx@@,jR3B+7 ?+> x,k; B,q9 B x,jz  Z"  >~,~
%

<f<@<"
B<I<@ R,kJ Q,kJZ& Q P,l	 P,lqZ& Q O,l	Z&
 Q O,l	Z&G Q N+l	<H<G<E<G<F<{
@
AXJSYS0XJSYSERRORPOINXJSYS1RORXJSYS2RORXJSYS3RORXJSYS4RORGETERRORSTRINGSTR2INTEINT2STREJSYS0UREJSYS1UREJSYS2UREJSYS3UREJSYS4URECHECKNUMSWAPLOWHALFWORDTONHIGHHALFWORDONXWORDUREJBITSUREBITSMAKEJSYSJUMPINDEXEDMOVESETZMREGENTRYJSTTMSGTJSMTALNTJSSETPVTJSMRPACTJSTWAKETJSTHIBRTJSRELSQTJSASNSQTJSRCVIMTJSSNDIMTJSXSIR%TJSXRIR%TJSRCUSRTJSRCDIRTJSACCESTJSSFUSTTJSGFUSTTJSLPINITJSGACCTTJSPRARGTJSCOMNDTJSSDVECTJSGDVECTJSSETJBTJSSTCMPTJSTBLUKTJSTBADDTJSTBDELTJSSFTADTJSRFTADTJSSOUTRTJSSINRSTJSDIAGSTJSSYERRTJSSFPOSTJSUFPGSTJSTEXTITJSRDTTYTJSTIMERTJSCHKACTJSALLOCTJSSPOOLTJSSNOOPTJSENQCSTJSDEQYSTJSENQYSTJSMUTILTJSMRECVTJSMSENDTJSGETJITJSSETSNTJSRDTXTTJSLNMSTTJSINLNMTJSCRLNMTJSHPTIMTJSRSCANTJSGPSGNTJSGACTJTJSATGRPTJSGDACCTJSVACCTTJSCGRPSTJSOPRFNTJSSWTCHTJSDELNFTJSJOBTMTJSADVISTJSSPLFKTJSESOUTTJSMSFRKTJSPEEKSTJSUSRIOTJSHSYSSTJSWAITSTJSGTDALTJSBPTYSTJSGTTYPTJSSTTYPTJSSCVECTJSGCVECTJSFLHSTTJSCVHSTTJSCVSKTTJSATNVTTJSWATDPTJSRDSDPTJSSTSDPTJSSTPDPTJSSTRDPTJSRELDCTJSASNDCTJSRELDPTJSASNDPTJSARCFSTJSBBNIITTJSSTOYSTJSSJPRITJSDSKASTJSSPRIWTJSDSKOPTJSGTDIRTJSCRDIRTJSDFOUTTJSDFINSTJSFLOUTTJSFLINSTJSIDTNCTJSODTNCTJSGTADSTJSSTADSTJSNINYSTJSNOUTSTJSIDCNVTJSODCNVTJSIDTIMTJSODTIMTJSSTPARTJSTLINKTJSLITESTJSGDSKCTJSFDFRETJSDIBESTJSFFUFPTJSSETNMTJSSPJFNTJSGPJFNTJSGEVECTJSSEVECTJSSSAVETJSSAVESTJSSFRKVTJSGETYSTJSGETNMTJSRWSETTJSSOBFSTJSSTIWSTJSRTIWSTJSGTRPITJSGTRPWTJSHALTFTJSDISMSTJSGFRKSTJSRFRKHTJSGFRKHTJSWFORKTJSHFORKTJSRFACSTJSSFACSTJSSFORKTJSRFSTSTJSRFORKTJSFFORKTJSKFORKTJSCFORKTJSEPCAPTJSRPCAPTJSRESETTJSSDSTSTJSGDSTSTJSRIRYSTJSRIRCMTJSSIRCMTJSCISYSTJSDTIYSTJSATIYSTJSDEBRKTJSRWMYSTJSRCMYSTJSDICYSTJSIICYSTJSAICYSTJSDIRYSTJSSKPIRTJSEIRYSTJSSIRYSTJSINIDRTJSDSMNTTJSMOUNTTJSDEVSTTJSSTDEVTJSDVCHRTJSATACHTJSDTACHTJSSTIYSTJSSFCOCTJSRFCOCTJSRFPOSTJSSFMODTJSRFMODTJSSTABSTJSGTABSTJSDOBESTJSSOBESTJSSIBESTJSCFOBFTJSCFIBFTJSMTOPRTJSPSOUTTJSPSINSTJSPBOUTTJSPBINSTJSCSYNOTJSRELDSTJSASNDSTJSDELDFTJSDUMPOTJSDUMPITJSCHFDBTJSGTFDBTJSSACTFTJSRMAPSTJSSPACSTJSRPACSTJSPMAPSTJSROUTSTJSRINYSTJSSOUTSTJSSINYSTJSBOUTSTJSBINYSTJSSWJFNTJSSFBSZTJSRFBSZTJSCNDIRTJSRFPTRTJSBKJFNTJSDIRSTTJSSTDIRTJSGACTFTJSSIZEFTJSRNAMFTJSCLZFFTJSCPRTFTJSRDDIRTJSFFFFPTJSJFNSSTJSSFPTRTJSDELFSTJSSTSTSTJSGTSTSTJSRLJFNTJSCLOSFTJSOPENFTJSGTJFNTJSGNJFNTJSSYSGTTJSRUNTMTJSTIMESTJSGJINFTJSGETERTJSERSTRTJSGETABTJSTMONSTJSSMONSTJSEFACTTJSCACCTTJSLGOUTTJSCRJOBTJSLOGINTJSJSYSSTOPENCODE4q;@@,~4q;,~4q; ,~4q; ,~4q; ,~O@Q$@@+ + ,~>Z"d,j9 BxG,q> x,q:>+j?ld"p+j6,j4d"pl"@,~	 not known in jconv6)1V+$0v+%+j46)0V+(d"pG*,~ *,jm+j?<l> Dx F H J~,q9 B~ x,q9 B} ,q9 B} ,q9 B| ~,j4 
 | } } ~(4q;@@>|+j6> Dx F H J~,q9 B~ x,q9 B} ,q9 B} ,q9 B| ~,j4 
 | } } ~(4q;>|+j6> Dx F H J~,q9 B~ x,q9 B} ,q9 B} ,q9 B| ~,j4 
 | } } ~(4q; >|+j6> Dx F H J~,q9 B~ x,q9 B} ,q9 B} ,q9 B| ~,j4 
 | } } ~(4q; >|+j6> Dx F H J~,q9 B~ x,q9 B} ,q9 B} ,q9 B| ~,j4 
 | } } ~(4q; >|+j66w1v+v1V+v+j3,~<> Bx @~ @~@@ d$p D  :l" d"4B:+| >,j9 B~@@  :l" d" B~4B   ~:l" df:+ ~d"pl"@>},~> Bx,qC B x,qC  >+qD,j4A"+j6,j4(BwA"+j6> Bx D,j4,qC(B	 B ,j4,qCG B>~+j6> B~ @ @x 
@@691V+& >~+j6 ~  B ~  D~6:0V+-  Fx  
+. BxZ*6:1V+00v+#6;1V+30v+#7 x+# 
x0l+#Z&/x  (F G F+#<~<<<x  ?,j<  ?+jm<S<z+l_FGFHFIFJFK<ILMNMOMPM<@MQR<@<UST<@U<@V<@W<@<UXY<VZ<V[<V\<V]^_`<@abacada<@<We<@<Wf<Wgh<@i<@j<@<@<J<@<@<Wk<Wl<Wm<@<@<@	FILE-DELETED-STATUSATTEMPT-TO-GET-JFNJFN-DELETED?JFN-RELEASEDELETEDFILE-DELETEJFN-TRUENAMEJFN-DELETEFILE-DELETE-AND-EXPUNGE
JFN-DELETE-AND-EXPUNGEFILE-UNDELETEJFN-UNDELETEFILE-READ-DATEJFN-READ-DATEFILE-WRITE-DATEJFN-WRITE-DATEFILE-BYTE-COUNTJFN-BYTE-COUNTFILE-PAGE-COUNTJFN-PAGE-COUNT	FILE-ORIGINAL-AUTHOR	JFN-ORIGINAL-AUTHORFILE-AUTHORJFN-AUTHOR	FILE-DATE-TO-STRINGFIXUP-FILE-NAMETRIM-FILENAME-TO-PREFIXFILE-SUPPORT > O,rL Bx3B+K N,kj B2@	+D -4kNr N,kj B2@	+< x,rM,jG B~ ,kk ~-4kP6M0V+A3@+@ M+B 
9+B  B ,kk  B  	 B D~ x,rM3@+J  ~,k{+L +L >~,~<<]<x<	-> c,rL Bx3B+a,rO B -4kNr c,kj B2@	+\ x,rO,jG B~ ,kk ~-4kP6b0V+` +` +a >~,~<<xO> x,rL Bx3B+u,rO B -4kNr w,kj B2@	+q x,rP,jG B~ ,kk ~-4kP6w0V+t +u +v >~,~<<xd > ,rL Bx3B+ ,kj B2@	+ x,rO B -4kNr ,kj B~2@	+ x,rQ,jG B~ ~,kk ~-4kP60V+
 +
  B ,kk  B  	 B D~ x,rM3@+  ~,k{+ + >},~<<x<	x > 8,rL Bx3B+5 8,kj B2@	+. -4kNr 7,kj B2@	+( x,rR,jG B~ ,kk ~-4kP670V++ +,  B ,kk  B  	 B D~ x,rM3@+4  ~,k{+6 +6 >~,~<<x<	 > X,rL Bx3B+U W,kj B2@	+M -4kNr W,kj B2@	+G x,rS,jG B~ ,kk ~-4kP6V0V+K +K  B ,kk  B  	 B D~ x,rM3@+T  ~,k{+U +U >~,~<<x<	9 > w,rL Bx3B+t w,kj B2@	+m -4kNr v,kj B2@	+g x,rT,jG B~ ,kk ~-4kP6v0V+j +k  B ,kk  B  	 B D~ x,rM3@+s  ~,k{+u +u >~,~<<x<	X > ,rL Bx3B+ ,kj B2@	+
 -4kNr ,kj B2@	+ x,rU,jG B~ ,kk ~-4kP60V+
 +
  B ,kk  B  	 B D~ x,rM3@+  ~,k{+ + >~,~<<x<	x > 6,rL Bx3B+3 6,kj B2@	+, -4kNr 5,kj B2@	+& x,rV,jG B~ ,kk ~-4kP650V+) +*  B ,kk  B  	 B D~ x,rM3@+2  ~,k{+4 +4 >~,~<<x<	 > V,rL Bx3B+S U,kj B2@	+K -4kNr U,kj B2@	+E x,rW,jG B~ ,kk ~-4kP6T0V+I +I  B ,kk  B  	 B D~ x,rM3@+R  ~,k{+S +S >~,~<<x<	7Never> Bx6d1V+\0v+\5B] e+c@@Z",k; BZ*H@@@@ x,q? >+q:>,~<V> Bx  x,j< B60V+k +l    B F~  D~61V+r ~>}+j: ,q3B+{3@~+x ,jG ~ B  D~+{ ,jG  D~ D~   B60V+ +  B+o<<> Bx,jJ B7 +  x,jC B1B+	 +	 
92B+
9 
1L+Z@@ x>~+jE>+<h<@<"<@,7,kJ 6,kJZ&Z6 5,l	Z&#Z6 5,l	Z&8Z6 4,l	Z&L<6<4,l	Z&m<6<3,l	Z&b<a<`<<]<[<{NAMESTRINGPATHNAMES$@> BxZ$Z"c,k; BZ*
@@ C x,q@ >+q:;6N1V+H0v+MZ*@@Z& O,qA N,kD4BM 
9,~ ,~<D6V1V+R0v+UZ*@@Z& V+qA ,~<6]1V+Z0v+\Z*@@Z& ^+qA ,~<6e1V+a0v+dZ*@@Z& e+qA ,~<6m1V+i0v+lZ*@@Z& m,qA+qC ,~<> Bx6{1V+r0v+y@@Z"1,k; B x@@,qDZ*4@@@@ ,q? >+q: >,~<> Bx6	1V+0v+	@@Z"1,k; B xZ",qDZ*4@@@@ ,q? >+q: >,~<6	1V+	
0v+	Z*@@@@@@+q? ,~<6	1V+	0v+	 Z",qDZ*@@@@@@+q? ,~<6	!1V+	0v+	  Z",qDZ*@@@@ 	"+q? ,~<	6	)1V+	%0v+	(Z*	@@@@@@+q? ,~<> Dx,rZZ*@@@@  x,k? 	<,j|  ,k` B B3B+	4 +	4 
92B+	8 
96	<1V+	8 3B+	:  +	; >~,~<<O<I	><"	?<i<@ 	b,kJZ& 	a 	a,l	Z&
 	a 	`,l	Z& 	a 	`,l	Z& 	a 	_,l	Z&$ 	a 	_,l	Z&+ 	a 	^,l	Z&3 	a 	^,l	Z&A 	a 	],l	Z&N 	a 	],l	Z&U 	a 	\,l	Z&_ 	a 	\,l	Z&h 	a 	[,l	Z&o 	a 	[+l	<[<\<`<_<^<f<e<d<c<a<b<\<^<{	=MAKE-PATHNAMEINSTANTIATE-FLAVOROBJECT-GET-HANDLERSET-VERSIONSET-TYPESET-NAMENAMESET-DIRECTORYDIRECTORYSET-DEVICEDEVICESET-HOSTHOSTPATHNAME-HOSTPATHNAME-DEVICEPATHNAME-DIRECTORYPATHNAME-NAMEPATHNAME-TYPEPATHNAME-VERSIONPATHNAMEPSTREAMPFILE-NAMETRUENAMESTRING-TO-PATHNAMEPATHNAME-FIELD-TO-STRING
PATHNAME-EMPTY-FIELD?FILE-NAMESTRING	DIRECTORY-NAMESTRING
USER-HOMEDIR-PATHNAMEINIT-FILE-PATHNAMEMERGE-PATHNAME-DEFAULTSPATHNAME$DESCRIBE
PATHNAME$DEFAULT-INIT*UNBOUND*PATHNAME$VERSIONPATHNAME$TYPEPATHNAME$NAMEPATHNAME$DIRECTORYPATHNAME$DEVICEPATHNAME$HOSTPATHNAME$SET-HOST	PATHNAME$SET-DEVICEWILDUNSPECIFIC
PATHNAME$SET-DIRECTORYPATHNAME$SET-NAMEPATHNAME$SET-TYPE	PATHNAME$SET-VERSIONOLDESTNEWESTPATHNAME-BITE
PATHNAME-FIELD-FROM-STRINGSTRING-IS-INTEGERSTRING2INTEGEROBJECTSASSOCIATION-CREATE
$FLAVOR-DEFINE-METHODDEFAULT-INITDESCRIBEINITABLE-VARIABLESVARIABLE-NAMES	INSTANCE-VECTOR-SIZEMETHOD-TABLE> Bx  ),r[ B2@x+
t +! x  B x  Dx3D+
r  B~  Dx 
2L(+  B~ (,r\  ~ ~ 
,k+
r 
2L'+  B~ ',r\  ~ ~ 
,k+
r 
2L&+  B~ &,r\  ~ ~ 
,k+
r 
2L%+  B~ %,r\  ~ ~ 
,k+
r 
2L$+  B~ $,r\  ~ ~ 
,k+
r 
2L#+
r  B~ #,r\  ~ ~ 
,k+
r >},~<k<N<l<{<l<m<m<n<n<o<o<p<H>,p9 Bx /,r\  x 
>+k<p>,p9 Bx 5,r\  x 
>+k<o>,p9 Bx ;,r\  x 
>+k<n>,p9 Bx A,r\  x 
>+k<m>,p9 Bx G,r\  x 
>+k<{>,p9 Bx M,r\  x 
>+k<N,>6W1V+Q +Q 
93B+V@@ x,j>3BX+V +V 
9>,~<<H 6_1V+\ +\ 
93B+_ ` +lH,~<<t+p9PathName
convertible to a pathname> Bx,rd3B+j x+z6{0V+m x>+rf6{0V+q x,j7>+rf x,re3B+x x B },r\   
,k>+rf | | x>+j3>,~<xac<t.><:>,p9 Bx,rb B x,rb B x,rc B~ x,rc B~ x,rd 
 ~ ~   D} F} H| J|3B+
,rg,q B{ 
@,q  {,jI+
 
?,q B{3@}+
 
?,q B{ },rg,q Bz 
>,q  z,jI  {,jI+
  
?,q B{3@}+
# },rg+
$ 
?,q Bz |,rg3B+
) |,rg2B+
. 
>,q Bz |,rg,q  z,jI+
. 
?,q Bz |,rg2B+
6 
>,q By |,rg,q  y,jI+
7 
?,q  z,jI  z,jI  {,jI  {>y+jI}~

.>,p9 Bx,rc B x,rc B x,rd    D~ F~3B+
L,rg+
M 
`,q B}3@~+
T 
`,q B} ~,rg,q  },jI+
T 
`,q B}3@~+
[ 
`,q B| ~,rg,q  |,jI+
\ 
`,q  },jI  }>|+jI
@
A><>,p9,rb Bx3B+
o 
r,q B x,rg,q B 
q,q  ,jI  >~+jI 
q>~,~
a
b
cPS>@@@@,q@ BZ$Z"2,k;   x B F~Z*@@@@ ~,q@ ~,q: B~  B~ 
,k  B~ 
,r\  ~ ~ 
,k >},~<m
r<n<HINIT> Bx,ri B B 
,kB 
,k>~,~ F H~,p9 Bx ,p9 B x,k8 Bx B~ ,r\  ~ 
,k2B+ B} ,r\  } 
,k B}  ~,r\  } ~ 
,k x B~ ,r\  ~ 
,k2B+ B} ,r\  } 
,k B}  ~,r\  } ~ 
,k x B~ ,r\  ~ 
,k2B+ B} ,r\  } 
,k B}  ~,r\  } ~ 
,k x B~ ,r\  ~ 
,k2B+ B} ,r\  } 
,k B}  ~,r\  } ~ 
,k x B~ ,r\  ~ 
,k2B+ B} ,r\  } 
,k B}  ~,r\  } ~ 
,k x B~ ,r\  ~ 
,k2B+ B} ,r\  } 
,k B}  ~,r\  } ~ 
,k x B~ ,r\  ~ 
,k2B+ x B~ ,r\   ~ 
,k x B~ ,r\  ~ 
,k2B+r\  ~ ~ 
,k x>},~<k<N<l<{<l<m<m<n<n<o<o<p  %w: %p%nAn object of flavor PATHNAME, has instance variable values:%n,> 4,kW x  3 3,kW x  2 3,kW x  2 3,kW x  1 3,kW x  1 3,kW x  0 3,kW >,~<N<{<m<n<o<pLOCAL 
F2L+9 
F L 
F2L+;  D 
F2L+>  D 
F2L+@  D 
F2L+C  D 
F2L+E @ ,~4<z ,~ ,~ ,~ ,~ ,~ ,~Invalid host specified for pathname.> Bx6i0V+Z ,q x B8+h  B3B+] +] 
92B+a 
96j1V+a 3B+g3D+g6j0V+g ,q x B8+h k>+j?>,~<<<PInvalid device specified for pathname.> Bx6
0V+u ,q x B8+2D+x @ +  B3B+{ +{ 
92B+ 
96
1V+ 3B+6+6
0V+	3D+2D+	<x<B8+Invalid directory specified for pathname.> Bx600V+ ,q x B8+/2D+ @ +/  B3B+ + 
92B+# 
9601V+# 3B+(610V+( ,q x B8+/600V+-3D2++2D2+-  x B8+/ 1>+j?>,~<<<<<Invalid name specified for pathname.> Bx6S0V+= ,q x B8+R2D+? @ +R  B3B+B +C 
92B+F 
96T1V+F 3B+K6T0V+K ,q x B8+R6S0V+Q3DV+O2DU+Q  x B8+R U>+j?>,~<<<3<<Invalid type specified for pathname.,>6j0V+` ,q x B8+i2D+b @ +i6j0V+g3Dk+f2Dk+g D +i j>+j?>,~<V<<Invalid version specified for pathname.61V+s0v+u4$u D ,~2D+x @ ,~60V+3D+}3D+}3D+}2D+ D ,~ +j?<l<	<	<<> Bx  },r[ @|@@| x 
8*xbJyn
y:  @@ B D F~ H~ J} 
| L} 
| L| 
3,}+ +w  x,rt B~ > xd"p:l" d"0B+#  B| ~//&  x,jE,rt B{ | |,r\  { | 
,k+u0B+.  B| ~//& : x,jE,rt B{ | |,r\  { | 
,k+u0B+X:} ~//&  x,jE B| 
}0L+A  B| |,rt B{ { |,r\  { | 
,k 
~3,}+u  B| {,r\  z | 
,k+u 
}0L+P  B| |,rt B{ { |,r\  { | 
,k 
~3,}+u  B| z,r\  z | 
,k+u 
}0L+u  B| |,ru B{ z |,r\  { | 
,k+u:} ~/>  x,jE B| 
}0L+e  B| |,rt B{ { |,r\  { | 
,k+u 
}0L+m  B| |,rt B{ { |,r\  { | 
,k+u 
}0L+u  B| |,ru B{ z |,r\  { | 
,k 
~ L+ >{,~x<k<<l<l<m<n<H,> 
 
"bBn:  xd"p:l" d" 0B+:3*+	 +  xd"p:l" d" :0B+ +3*+ +  xd"p:l" d" :0B+ +0B+  >,~x*,>6(0V+' 
$(bD)n)5$# ++' *,jS3B+& *+' x>,~<x<<*0-2,>6C0V+B 
$DbDDnE5$4 +B H,jS3B+7 G+B G x,jS3B+; F+B F x,jS3B+> E+B x,ru3B+B x>+rv x>,~<x<+<	,<	-,rg 
"NbBNnO4"M ,~ 
9,~x%w*0-26b1V+b2Bg+X f,~2Bf+Z e,~2Be+\ d,~2Bd+^ c,~2B+` d,~  c+j>,~<OP<Q<R<	S<	> Bx 
$wbDwnx@@ B D 
3l+o 
9+vBxd"p:l"d",q2B+u +v:+l>~,~xZ&Z$+l6<p|<	<@<o}<n~<m<{<N<@ ,kJ ,kt3B+   ,jnZ&  ,l	Z&;  ,l	Z&A  ,l	Z&G  ,l	Z&M  ,l	Z&S  ,l	Z&Y  ,l	Z&  ,l	Z&j  ,l	Z&r  ,l	Z&x  ,l	Z&  ,l	Z&T  ,l	Z&u  ,l	Z&  ,l	Z&!  ,l	Z&/  
 ,k 
  ,k   ,k 
 
 ,rwZ&/  
,l	 	 	 ,rwZ&G  	,l	   ,rwZ&X  ,l	   ,rwZ&Z  ,l	   ,rwZ&[  ,l	   ,rwZ&]  ,l	   ,rwZ&^  ,l	   ,rwZ&`  ,l	   ,rwZ&f  ,l	   ,rwZ&  ,l	   ,rwZ&%  ,l	   ,rwZ&I  ,l	 ~ ~ ,rwZ&l  ~,l	 } } ,rwZ&  },l	Z&  |,l	Z&  |,l	Z&/  {,l	Z&@  {,l	Z&Z  z,l	Z&f  z,l	Z&y  y+l	<	<v<v<	<	<	<u<k<	<l<	<l<	<m<	<n<~<o<~<p<}<o<}<n<|<m<|<{<{<N<{<	<z<	<y<	<	z<		<		<y<x<x<w<w<i<H<u<t<s<s<r<r<q<q<p<j<<{y<	{$DEFFLAVOR-ERRORFLAVOR-NAMEDEFFLAVOR
$DEFFLAVOR-PROCESS-VARLIST
$DEFFLAVOR-BUILD-DESCRIBE$DEFFLAVOR-PROCESS-OPTIONS-LIST
$DEFFLAVOR-CREATE-METHODS$DEFFLAVOR-INITABLE-VARSFLAVORDEFMETHOD$DEFFLAVOR-FUNCTION-NAME
$CREATE-METHOD-SOURCE-CODEMETHODSOURCE-CODESELF=>SEND
$DIRECT-SEND-EXPANSION
$NORMAL-SEND-EXPANSIONDECLARED-TYPESEND-IF-HANDLES***HANDLER******SELF***LEXPR-SENDLEXPR-SEND-1
LEXPR-SEND-IF-HANDLESLEXPR-SEND-1-IF-HANDLESEV-SENDMAKE-INSTANCE$OBJECT-PERFORM-INITIALIZATIONINITOBJECT-TYPE	$FLAVOR-FETCH-METHOD	TRACE-METHOD-LOOKUPS	$METHOD-LOOKUP-STATS
$TRACED-OBJECT-GET-HANDLER
UNTRACE-METHOD-LOOKUPSSTRINGXPRINT-METHOD-LOOKUP-INFOSTRING-PAD-LEFT	$METHOD-INFO-SORTFNDECLARE-FLAVORUNDECLARE-FLAVOR$OBJECT-LOOKUP-VARIABLE-IN-LIST$SUBSTITUTE-FOR-SYMBOLSASSOCIATION-BIND
$DEFFLAVOR-PROCESS-OPTION$DEFFLAVOR-OPTION-TABLE*NONE*$DEFFLAVOR-DO-GETTABLE-OPTION
$DEFFLAVOR-INSERT-KEYWORDGETTABLE$DEFFLAVOR-DO-SETTABLE-OPTIONSETTABLE$DEFFLAVOR-DO-INITABLE-OPTIONINITABLE$DEFFLAVOR-DEFINE-ACCESS-FUNCTIONNEW-VALUE$DEFFLAVOR-DEFINE-UPDATE-FUNCTIONASSOCIATION-LOOKUPASSOCIATION$OBJECT-NUMBER-OF-RESERVED-SLOTS	$OBJECT-FLAVOR-SLOT$OBJECT-DEBUG-SLOT	FLAVOR-DEFINE-METHOD
S<{s<{t<{uvwv<@DEFFLAVOR %w: Component Flavors not implemented<	<@<	<@<	<@<	<@<		<@<{xy<@<		<@<	<@> Bx   D    F        H~ 
 
( 
( 
( J~  ,r|  D}   F} ,r} B| ~ } ,r} B{  ,r~ B| { ,r~ B{ } W ,k V ,j< Bz } ,j< z,j| V,j| |,j< B| U ,j< Bz | ,j< z,j| V,j| |,j< B|3@~+$  U,j>  Z"t,jg  T,jm T,j< S,j|  S,jm Bz  T,jm R,j< R,j|  z Q,jf Bz  T,jm Bz },j; Z",jj  Q z R,jn Bz  T,jm By } T,jm  P y R,jn By  T,jm By { T,jm  P y R,jn By  O,jm  T,jm,jG  |,jI y,j| y,j| z,j| z,j| O>x+j|<<	fgh<H<i<<j<{kq<	r<	<{X<{<@> Bx    D     F      
 
( 
( J~  ,j< B~  ,s B} ~ ~,j< ,j|   },k  },s B}  ,jm B|  ,jm B| } ,jm  | | ,jn B| } ,jm B| } ,jm   | ,jn B|   ,jf  ,jm  | | >{+jn<<	<}W<	<{<	<~<	> Bx   D    F      H~  ,jm ~,j< ,j| >~+j|<	<{> Bx   D    F      H~620V+/ 
42L+/3@+/ 
620V+/   B~2D4+&3@"+& >}+s630V+- 3 ,kv3B+- ~ ~ >}+s ~  >}+s   >}+s<<0<<	<	<{> Bx   D    F      H~ O,jm B~  O N,jf  N,jm  ~,jm B~ ~ O,j< M,j|  N M,jf  N L,jf  ~ L>}+jf<_<<<z<	<W<	P<@<zQ<	<@> Bx   D    F      H~3H+j ,k	 ,k	 B~ ~,k  ~ B} D}3B+g v,j| }  u,jf    u>|+jn    u>|+jn t,jm,jG B~  t t,jf s,j< s,j|  ~ r>|+jf<F<O<k<	<	<X<zw<@<x<	yz<@<{<	|}<@<z~<	<@> Bx   D    F      H~3H+ ,k	 ,k	 B~ ~,k  ~ B} D}3B+ #,j| }  #,jf    ">|+jn    ">|+jn ",jm B~  " !,jf  !,jm  ~,jm  ,j<  >|+j|<_v<	<W<	<	<X<z> Bx   D    F        H~ 8,jm,jG B~  8 8,jf B} ~ 8 7,jf  } 7,jf  ~ 6>}+jf<F<<K<k<	> Fx B,r\ B x ,j<  >~+kt> Bx   D    F        H~ Y,jm B~  Y Y,jf  X,jm  ~,jm B~ ~ Y X,jf  X W,jf  X W,jf  ~ V>}+jf<_<<<K<	<W<	> Bx   D   F  c,j<   b>~+jf<j<zAttempt to instantiate undefined flavor: %w> Bx D ,kv B3B+,k,k: B~ 
x L  D ,k Z" B~ D} } ~,jg3B+w +{ ~.~ 
 L ~,ji B~+s  ~,s
 ~ B~ ,lH3B+  ~ 
,k ~ B~ ,lH3B+   ~ 
,kw~+ex ,j>B~x,jfB~s,jf~,jf  ~@@>}+jg>},~<jc<	<	<z<		,>60V+,j@Z$,jg3B+ x 61V+ + >,~<Object %w cannot receive messages.
2B+>   @,j> B~ x,jf B} ,jf  } @,jf  ~+= x ?,j> B~ x,jf B~ ,jf  ~ @,jf  ~Z"t>}+jg>},~<k#,>,s3B+E x>+s
 >,~,rw B+ J I+k<k<	 M L+k<k<	%w  %w%n%w<fQ<	<@>,s m,kJ l +,pW B+  
+Lx6j0V+[x+[B6j1V+^+il,j>Z$,s	k,kWxiBx6k0V+hA+h oB+\>,~<x<MO<	PVariablenameinDECLARE-FLAVORisnotVanID:%pFlavor*nameinDECLARE-FLAVORis not4anID:%p>BxDF61V+,j>,j?+	B~F~60V+t+avB~60V+61V+~,j>,j?+kv B~ Y ,kv B~  B}  B}2@+E +W   B}   D3D+L  F}  D+M  F} ~,k3B+S } ~,s .x 
} L+C  } X,j>  Z"t,jg+C>|,~5<	<	> Bx D  
x L6p0V+`  +a Z$ B~ D~6p1V+e +o 
~2L+g ~+o ~,ji B}   D6q0V+m +m  B~ } B~+b>},~<<> Bx D60V+{  ,s3B+z  
 
>~+jf x+60V+ 
	3L+ 
	2L+ ,r >~+j| ,r B  x ,r >~+j|>~,~<<h<<{<O<	,>,> ,kv  x>+s<		,> ,kv  x,k3B+ + >,~<		> Bx D % ,kv B % x,kv    B~ D~-4kN	  ~,mH ~,s-4kP>},~<	<	DEFFLAVOR %w: Bad item in variable list: %p,<@<{-<z<@> Bx D @ @~ @~ @}  D}6\0V+5 +6  B|6]0V+Z6]0V+J 
|6^0V+J |  B} |  D~3D+@  D~ a,j< `,j| B| ~ } `,jf  | _,jf B~  ~,k  B~+R6]0V+M 
| L}+R | x _,j>  Z"t,jg  B}3@}+U } ,k  B }  B}6^0V+Y +Y  B|+6 ~ >{+jm<<}<|<0<&<H<h<Z+  %w: %p%n, has instance variable values:%n	An object of flavor > Bx D ,q B x,j7,q B~ ,q  ~,jI  ,jI  ,jm,jG B  
 L~6
0V+{ ~ +{  B~6
1V+~ +
,~,~  ,k  B ~  D~6
0V+ +	  B~+|  >}+k <~<a<{<fcg> Bx D F,rw B~  
 L~6$0V+ ~ +  B}6$1V+ +# } ~  x,s ~  B~6%0V+! +"  B}+ ~>},~<~<DEFFLAVOR %w: Bad option in options list: %wDEFFLAVOR %w: Bad item in options list: %p> Bx D F H~   B~ D}6N0V+8   B~   D}+@6N0V+; H~+@  x O,j>  Z"t,jg 
O L~ 
~3LO+L 2 ~,k2B+H ~ x N,j>  Z"t>}+jg 
 }   x 
>}+k >},~<%<	#* 
Q+s<	% 
S+s<	& 
U+s<	'DEFFLAVOR %w: %p (in keyword option) not a variable.> Bx D F H~ J~2H+a D~  
~ L}60V+e } +f  B}61V+i +  },k2B+p } x ,j>  Z"t,jg+y  },k B|2B+v },jG B|  ,k  |  ~,k* B| | B8 }  B}60V+} +~  B}+f>{,~<}<V,>,jm x   >+jn<	<	(<@SET-> Bx D ,q B ,j7,q  ,jI,l	  x,jm B~  ,j< ,j|   ~ >~+jn<	<h> Bx D  B  D~6:0V+ +   B~6:1V+# +8 ~  ~  B} D} <,k2B+* } ;,k3B+- } x,s ,j< B } ;,k3B+3 } x,s ,j< B ~  B~6;0V+7 +7  B~+  >|,~<<~<<	&<	%> Bx D  D6]0V+B +B    B~ D~ F}6^1V+G ~+\6^0V+W ~  `,k2B+O ~  _,k3B+W3@}+T ~ ,jG } B8 }  B}+W ~ ,jG B} B~   B6_0V+[ +[  B~+E>},~<<<~<<	&<	'$> Dx,j7,q B k,q B x,j7,q  ,jI  ,jI>~+l	`> Dx F  |,jm,jG B x | {,jf B~  |,j< {,j|  ~ z,jf   z>~+jf<F<<z<k<	> Dx  ",s B x ,j< >+j|<	> Bx D F ,kv ,s B~  x,j< ~>~+j|<	>,s Bx  +,s3B+,ji+Z"  x +,s x>,~   +q-<	)<"<f<@<"<@*DUMMY****RESULT******PAIR***	MAP-OVER-ASSOCIATION ' ',j<+jG<	-> Bx D F  ,k3B+. 
 L+:  ,j<  x,k  x  
;2L+9 
;2L+9 x  ,k x 
 
0 L+: >~,~<	-,>  x,k3B+@ +@ >,~<LFG<@H<@I<@J<@<	.<@<AF<{K<^L<]L<	-<@<	.<@> Bx    D     F          H~ 
 
( J~  z z,jf B} y ,j< B} y ~,j<  },jm B} x ,j< x,j|  w,jm B| ~ w,j<  v v,jf  |,jm  u,jm  } u,jf  t,jm t,j< s,j| },j| s>|+j|<uAB<r<F<<h<	.<<<ZCDE<r<	.<"<@
D20FOR$TOPLEVEL-PARSERECD20FOR$NEXTRECORDRDD20FOR$PARSECO
D20FOR$STMT-COLLECTORESS	D20FOR$NEXTSTATEMENTREC	D20FOR$CURRENTRECORDREC	D20FOR$CURRENT-LINED20FOR$MESSAGED20FOR$PARSE-ERROR-D20FOR$LINE-COMMENT-COLLECTORILLSTMTESFOR$STMTRLABELCODE-COMMENTT-NORMALMMED20FOR$TOPLEVEL-1TOD20FOR$COMMENT-COLLECTORD20FOR$TOPLEVEL-AKD20FOR$TOPLEVEL-BKD20FOR$TOPLEVEL-CKD20FOR$TOPLEVEL-DKD20FOR$TOPLEVEL-EKD20FOR$TOPLEVEL-FKD20FOR$TOPLEVEL-GKD20FOR$TOPLEVEL-IKD20FOR$TOPLEVEL-LKD20FOR$TOPLEVEL-NKD20FOR$TOPLEVEL-OKD20FOR$TOPLEVEL-PKD20FOR$TOPLEVEL-RKD20FOR$TOPLEVEL-SKD20FOR$TOPLEVEL-TKD20FOR$TOPLEVEL-UKD20FOR$TOPLEVEL-WKD20FOR$TOPLEVEL-DEFAULT
D20FOR$GENERAL-EXPRESSIONENTD20FOR$IDD20FOR$TOPLEVEL-DEFAULT-PRINTD20FOR$TYPE-SIZEPRED20FOR$ARITHMETIC-CONSTANT-EXPRESSIONdeD20FOR$UNSIGNED-INTEGER-CONSTANTen
D20FOR$TYPE-SIZE-PRINTD20FOR$ID-LIST	D20FOR$ID-LIST-PRINTD20FOR$TOPLEVEL-1-PRINTND20FOR$TOPLEVEL-A-PRINTND20FOR$TOPLEVEL-B-PRINTND20FOR$TOPLEVEL-C-PRINTND20FOR$TOPLEVEL-D-PRINTND20FOR$TOPLEVEL-E-PRINTND20FOR$TOPLEVEL-F-PRINTND20FOR$TOPLEVEL-G-PRINTND20FOR$TOPLEVEL-I-PRINTND20FOR$TOPLEVEL-L-PRINTND20FOR$TOPLEVEL-N-PRINTND20FOR$TOPLEVEL-O-PRINTND20FOR$TOPLEVEL-P-PRINTND20FOR$TOPLEVEL-R-PRINTND20FOR$TOPLEVEL-S-PRINTND20FOR$TOPLEVEL-T-PRINTND20FOR$TOPLEVEL-U-PRINTND20FOR$TOPLEVEL-W-PRINTN
D20FOR$PREVIOUSRECORDREC,s!+s!
Statement not recognized.NEs> ,jG  Dx-4kN	1,s"2B+> +  A3@+I B  A   
,jn B A ,s$    	,jf  @,jG+p 

9 Lx    A  B D F~ H~ A3@+Q  	+Q  
 A   A  ~,jn B}7@+X   ,jm,jG+Y  B},s$  D~ },jI },j|  ,j| B  @,jG ~ B}6 1V+c +d 
93B+h } 3B +h +h 
93B+p A  ~-4kN	2	4      ,s% 

9 LD-4kP  E,k	 B6 0V+u +u  B6 0V+~  @,jG   B6 0V+} +}  B+v  BE+<3@x+  @ +  -4kP>|,~<<<l<	64<~<	6<	7<X<	7<	8>,s) Bx3@H+  H,k  ,j|  x>+jm>+jG<	7>    

 Lx,p~ 
x L
0B + ,s*+ ;0B!+ ,s++ ;0B!+ ,s++ ;0B"+  ,s,+ ;0B"+ ",s,+ ;0B#+ $,s-+ ;0B#+ &,s-+ ;0B$+ (,s.+ ;0B&+ *,s.+ ;0B'+ ,,s/+ ;0B'+ .,s/+ ;0B(+ 0,s0+ ;0B)+ 2,s0+ ;0B)+ 4,s1+ ;0B*+ 6,s1+ ;0B*+ 8,s2+ ;0B++ :,s2+ ;>+s3>,~=0FO<> ?<> @ A B A C(T* D E<	B F<> G H I J K<	C<@:0FO D K<> L M<@ N<@)0FO<= O P Q,PEA<	B<@> 
 Bx  w,kj B2@	+ r  v,kj B2@	+ h ,jG 
 B~ D~    v,pw ~ ~  u,pv ~ ~  u,pv ~ ~  t,pw ~ ~  t,pw ~  B~ ,kk ~ B3B s+ n,pk3B+ n    w,kh+ o 
x L
 
x L
  s B ,kk >},~<~<	B < = ><	C<<}=0FO<> z<> { | } | ~(T* !<	B!<>!!!!!<	C<@:0FO !<>!!<@!	<@)0FO<=!
!!
,PEA<	B<@> Bx  B !@,kj B2@	+!; !?,kj B~2@	+!56!<1V+!  !?,kh  B~ x B}  B}  ~ !?,p|3B+!  }  D}  F} } } ~ !>,p{ B}  D}   ~ !>,p{ B}  D} !=  ~ !=,p}3B+!. }  D}  F} } ~ !=,p|3B+!3 }   
9 B~ ~,kk ~3B+!8 
9 !@,kh 
 L  B~ ,kk ~>|,~<x<	B w x y<	C<<})TTE(TTE*TTE> 
 Bx ",kj B2@	+" ",kj B2@	+!T ,jG 
 B~ D~   ",pw ~ ~ ",pw ~  B~ ,kk ~3B"+!W  ",kh+!X 
x L
 ",kj B2@	+!h ,jG 
 B~ D~   ",pw ~ ~ ",pw ~ ~ ",pw ~ ~ ",pw ~  B~ ,kk ~ B3B"+!k  ",kh+!l 
x L
 ",kj B2@	+!x ,jG 
 B~ D~   ",pw ~ ~ ",pw ~  B~ ,kk ~3B"+!{  ",kh+!| 
x L
 
x L
 " B ,kk >},~<	E!@!A<~<	E!B<<})TTE(TTE*TTE> Bx  B "k,kj B2@	+"f "j,kj B~2@	+"#6"g1V+"  "j,kh  B~ x B}  B} "j  ~ "j,p}3B+" }  D}  F} } ~ "i,p|3B+"  }  D}  
9 B~ ~,kk ~3B+"% 
9 "k,kh "j,kj B~2@	+"H6"g1V+"+  "j,kh  B~ x B}  B} "j  ~ "j,p}3B+"4 }  D}  F} "i } ~ "i,p}3B+": }  D}  F} "j } ~ "j,p}3B+"@ }  D}  F} "h } ~ "h,p}3B+"F }  D}  F} 
9 B~ ~,kk ~3B+"K 
9 "k,kh "j,kj B~2@	+"`6"g1V+"P  "j,kh  B~ x B}  B} "j  ~ "j,p}3B+"Y }  D}  F} } ~ "h,p|3B+"^ }   
9 B~ ~,kk ~3B+"c 
9 "k,kh 
 L  B~ ,kk ~>|,~<x<	E""<	E"<<}<>"l"m<@<="n"o"p,PEA<	C<@> 
 Bx #
,kj B2@	+#	 #
,kj B2@	+# ,jG 
 B~ D~   #,pw ~ ~ #,pv ~  B~ ,kk ~3B#
+#  #
,kh+# 
x L
 
x L
 #
 B ,kk >},~<~"k<	C<<}<>##<@<=###,PEA<	C<@> Bx  B #4,kj B2@	+#1 #4,kj B~2@	+#+6#21V+#  #4,kh  B~ x B}  B}  ~ #3,p|3B+#& }  D}  F} } } ~ #3,p{  
9 B~ ~,kk ~3B+#. 
9 #4,kh 
	LB~,kk~>|,~<x#
x6#k0V+#h x ,j7@@d"p:l" d"0B +#? x>+s90B!+#B x>+s90B!+#D x>+s:0B"+#G x>+s:0B"+#I x>+s;0B#+#L x>+s;0B#+#N x>+s<0B$+#Q x>+s<0B&+#S x>+s=0B'+#V x>+s=0B'+#X x>+s>0B(+#[ x>+s>0B)+#] x>+s?0B)+#` x>+s?0B*+#b x>+s@0B*+#e x>+s@0B++#g x>+sA +#j x>+s5>,~<0<	0<@<	2<@<	P<@<{<@<<@<|<@<	2<@<	5<@<	5<@<	9<@<	1<@D20FOR$OPEN-LISTING-FILE
D20FOR$LISTING-CHANNELNA	D20FOR$IN-FILE-NAMED20FOR$NEW-LISTING-PAGEAD20FOR$HEADING1HANN	D20FOR$LISTING-PAGED20FOR$HEADING2ght D20FOR$CURRENT-LISTING-LINE-NUMBER
D20FOR$CLOSE-LISTING-FILEE-NU	D20FOR$INSERT-ERRORSLLED20FOR$LIST-INPUTRS
D20FOR$LISTING-LINE-QUEUEE-NUFORMAT-STRING-
D20FOR$INCLUDENESTINGLEVEL-NUD20FOR$BUILD-ERROR-MESSAGE-STRINGD20FOR$INCOMPATIBILITY-REPORTD20FOR$I_COUNTD20FOR$S_COUNTD20FOR$W_COUNTD20FOR$E_COUNTD20FOR$F_COUNT	***SETLINELENGTH***
D20FOR$ERROR-MESSAGE-LIST-NUD20FOR$REPORT-LINE-TO-TERMINALNGD20FOR$RECOMPILEORS	D20FOR$MSG-LINE-FLAGLEVED20FOR$NOTIFY-RECOMPILEPROWONCOM
D20FOR$VERBOSE-MESSAGER	D20FOR$REMOVED_COUNTUNIT
D20FOR$OTHER-MESSAGESISTMAKE-VISIBLE-CHARKSERROR-COMPARE-FNKSD20FOR$LISTINGLINE-TO-LISTINGNG-PD20FOR$REPORTE
D20FOR$LINES-PER-PAGE-LI
D20FOR$SETTINGS-REPORTI
D20FOR$MESSAGE-REPORT-RED20FOR$SOURCE-DIRECTORYTD20FOR$TARGET-DIRECTORYTD20FOR$OUTPUT-EXTENSIONiD20FOR$VERBOSE
D20FOR$DEBUGGING-FLAGDOMD20FOR$EXECUTE-DOG-
D20FOR$DEFAULT-WRITE-UNITNE	D20FOR$UNIT-5-OUTPUTUNITASGOTOLSTBADARTHOPBADCLSOPTBADFRMITMBADFRMTNXBADLOGOPdBADOPNATRBADOPNOPTBADRELOPoBDDFLTFMTBDOPNSTSTBITHACKioBITHACKASBITHACKEQCHRCNSARGCOMPARMLIDECFORCINCableGENDECLSoHOLCNSARGIDTRNC6h NOTCREATED truOBSCNSTRCOCTCNST oONETRIP cRENAMEDmoSEQOUTWRNSZMSMTCHFUNTRNCNSTVARUSED2AWRTDFLTMDWRTUNTMODZERTRIPDO.TMPLISO2B+%6  Ba,~2B
9+%: a,k9 Bb %A,pF+%;,p=,q Bb b,pB %A,jI Bb %@,l BaZ$B+l'<1%1%2,>3D+%GZ",jG,k>  x,lM c x,lM d,ji Bd a,pC d  d x,lMZ" Be>,~3@a+%S  a,lM+sG ,~%w%n%w%w%w	IS-SE EN00000-STR> Bx D3@a+%s g B x,j< Bg  Bx  D  Bx3B+%s %v,sI B6@h+%g %v+%g %u B~6@h+%j %v+%lZ$ h,jj,jG,k> 
 ~  %u a,lM x,s$  %t a>~+lM >~,~%T%U%V%W%X	%%TRANSFORT-%w-%w %wY-REF0FOE0FOW0FOI0FO> Bx D F ,l	 i,k B~3B+&  ,ji ~ 8 B8 
x2L&#+& i,ji Bi &"+& 
x2L&"+& j,ji Bj &"+& 
x2L&!+& j,ji Bj &!+& 
x2L& +& k,ji Bk & +& 
x2L&+&k,jiBkx&+&&>~+j>%w%z<%{<l%|<<%}<-TRANSFORT-I-TRANSTERM Translation terminated.%nn> Bx D F3@l+&/Z$B 
x2L&;+&9 &:,kB,sG>~+k\ >~,~&#<Recompile on DEC 10/20 to determine cause of error.age
Program won't compile Tr,s%  Bn &M &L &L,sP &K &K &J+sP<<	_&;<l<	`&A> Bx D F p,ji Bp   x,sJ>~+sN>,sJ  Bx-4kN	^,sN q x,j< Bq-4kP>,~%nOR-TRANSFORT File %w at source line %w.%n%w%n  &k,kB3@n+&i a,pC C  &j,kB &j+kB&\&]&b> Bx,jJ B@@ ,jg3B+&s  x,jC1B+&t +&v ,k B+&n @@ x>+jE%pMS> Bx ',j>  x,jI B,jJ B x,jJ  ,jh B x,jJ   >~+jE&xASCII SIB%pMS,>Z$?,j~3B+'Z$ x,j~2B+'Z& xZ",jf>+k> x ',j>  '>+jI''  +j~;0FOEXT->3@r+'Y a,l# '] b,l Bx b,pC '\,l B@@ B '\ l,q5 B~  B~ '[ B}Z$B ,l' ~  B} ~  D~ B~  ,sD ~7@8+'/ +'6 ~  ,sT ~  B} ~  D~ B~ '[ ,sT+', x,l9 '[ B},jS3B+'; +'K } ,sT ,ji B ~ ,jR3B+'6 ~  ,jR3B+'I ~  ,sT ~  B} ~  D~ B~+'@ '[ ,sT+'6 '[ ,sT2@q+'O +'T q  B} q  Dq  ,sT+'M ,sU x,l# ,l# '[ b,jI>|+rN >|,~''<	b<1<2%w%n,>,> e,ji Be t,jg3B+'e 
9 x,sD  'g x>+lM'],> 
9,sD x,sV x,sJ x>+sV
Unit-5-Output:      %wIT
Default-Write-Unit: %wNA<not used>LT-<default 6>LT-
One-trip:           %wNAdisabledEenabledXE
Debugging:          %wNAIgnoreEBIncludeEB
Verboseness:        %wNA<default 0>SEHANN
Listing file:       %wE
Output-Extension:   %wE<default VFR>E
Target Directory:   %wE
Source Directory:   %wRE<none specified>ECT,> u2B+( (_  (^,j>  x,sT v2B+(" (_  (^,j>  x,sT v2B+(' (]  (],j>  x,sT b,pC  (\,j>  x,sT (\ x,sT w2B+(1 ([  ([,j>  x,sT3@w+(6 (Z+(7 (Z  (Y,j>  x,sT3@x+(< (Y+(< (X  (X,j>  x,sT3@x+(E6(U1V+(C0v+(D x+(E (W+(E (W  (V,j>  x,sT3@y+(N6(U1V+(L0v+(M y+(N (W+(N (W  (V,j>  x,sT (\ x,sT (\ x>+sT<x<y'm'p's'u'w'z'|'}((((((	(
((((%w Incompatibility Message%w issued.%ns werempa wasNoEHANN%w%t%w%t%wTING     -STR--------------- -------- -------RIncompatibility Messages Issued:R> Bx  B )- x,sT )- x,sT  
i L6)(0V+(~  +(~ @@ B~ D~6)(1V+) ~+)@@ ~  ,jg3B+) ~   ),,sI B|Z*$ ~      Z& ~  ),,j>  x,sT ~   ~,jj B~   B6))0V+) +)  B~+) B )+ x,sT@@ ,jg3B+) +) )+ B 
0L+)! )*+)! )*   )),j>  x,sT )+ x,sT )+ x>}+sT<<(_(d(e(f(g(h(j(l(p!(%w message%w progress information and%wnot appear in the listing.).5 do  does REM	%w message%w issued.GEIs wereage wasNoNFatal:       %wNG-PError:       %wNG-PWarning:     %wNG-PStatus:      %wNG-PInformation: %wNG-P     -STR---------Messages:HANN> BxZ$ t,jh  e,jg3B+)W 
9 x,sD * x,sT * x,sT * x,sT i *,sI  *,j>  x,sT j *,sI  *,j>  x,sT j *,sI  *,j>  x,sT k *,sI  *,j>  x,sT k *,sI  *,j>  x,sT * x,sT k k,jj  j,jj  j,jj  i,jj B5B){ * B 
0L+)~ *+) *   *,j>  x,sT * x,sT@@ p,jg3B+* p0N+*	 *+*	 * B p0N+*
 *+*  p *,j>  x>~+sT >~,~).)5)6)8);)<)=)>)A)C)F)H)K)L)N)O<	\<@*K*L<	Y<@<	a<@<	\<@<	[<@<	[<@<	Z<@<	Z<@<	i<@<	i<@<	h<@<	h<@<	g<@<	c<@<	f<@<	f<@<	a<@<	]<@<	^<@<	X<@<	W<@<	T<@<	d<@<	U<@<	4<@<	2<@SOURCE LISTING - FILE: %w					Page %w%n %nti<	U<@(TRANSFORT Copyright (C) 1986 Lexeme Corporation                   V1.5 1-Mar-86%nn a<	T<@<	Q<@<	R<@<	S<@<	R<@<	g<@<	j*M*N*O*P<	j*Q*R*S*T<@*Y<	k*Z*[*\Assigned GOTO lists detected - ignored by VAXn   *]<@*d<	k*e*f*gArithmetic operator used on numeric or character operands  *h<@*m<	l*n*o*pCLOSE option used which is invalid in VAX FORTRAN*q<@*u<	l*v*w*xFORMAT R descriptors replaced by A*y<@*~<	m*++FORMAT X descriptors replaced by (' ')A+<@+<	m+++	Logical operator used on numeric dataA+
<@+<	n+++OPEN statement missing ACCESS or STATUS specifier+<@+<	n+++OPEN option used which is invalid in VAX FORTRAN+<@+"<	o+#+$+%Undefined use of relational operatorsAX+&<@++<	o+,+-+.FORMAT descriptors without a default valueRT+/<@+5<	p+6+7+8OPEN option STATUS behaves differently under VAX FORTRAN  +9<@+@<	p+A+B+CExpressions mixing character, logical, and numeric data  +D<@+J<	q+K+L+MAssignment mixing character, logical, and numeric data+N<@+T<	q+U+V+WEquivalencing character, logical, and numeric dataata+X<@+]<	r+^+_+`Character constants used as actual arguments+a<@+e<	r+f+g+hCOMMON variables passed as argumentsgum+i<@+o<	s+p+q+rDeclarations were forced into an INCLUDE filedata+s<@+y<	s+z+{+|Identifiers were generated and declared by TRANSFORTa+}<@,<	t,,,Hollerith constants used as actual arguments,<@,
<	t,,
,Identifiers truncated to 6 charactersum,<@,<	u,,,INCLUDE file created only onceacte,<@,<	u,,,Obsolete or non-portable constructssum,<@,$<	v,%,&,'An octal constant was found in an expression,(<@,,<	v,-,.,/DO-loop modified to execute once.e,0<@,3<	w,4,5,6	INCLUDE file renamedxecu,7<@,<<	w,=,>,?ACCESS='SEQOUT' behaves differently under VMSNSFO,@<@,G<	x,H,I,JFORMAT A descriptors require variable with more storage on VAX  ,K<@,O<	x,P,Q,RUntranslatable construct in source,S<@,X<	y,Y,Z<@Variables used twice in same argument listmo,[<@,a<	y,bWRITEs to default unit modified to include 'UNIT=n'age,c<@,hWRITEs to unit 5 modified to specified unitU,i<@A Zero-Trip DO loop was encountereded u
D20FOR$OPEN-INPUT-FILE-LD20FOR$IN-CHANNELED20FOR$CLOSE-INPUT-FILEeD20FOR$READ-NEXT-PHSICAL-RECORDeen
D20FOR$CLEARFORTRANRECL-
D20FOR$GET-LINE-FROM-FILEECORD20FOR$SCAN-TABLE-FD20FOR$ENDOFCURRENTFILE
D20FOR$PREP-NEXT-LINEL-LD20FOR$NEWRECORD-LE
D20FOR$INCLUDEFILEHISTORYTORD20FOR$TERMINATE-INCLUDED20FOR$NEWRECORD1ED20FOR$RECORDCURRENTFILETESTANDBLANKSEMIORDINCLUDE-MARKERD20FOR$RESTORELASTINCLUDEFILE
EXTRACT-LIST-OR-NOLISTleD20FOR$CONVERT-INCLUDE-OPTIONSund
D20FOR$INCLUDE-LIST-OPTIONOR
REPLACE-LIST-OR-NOLISTOP
DETERMINE-OUTPUT-NAMETIO
PROCESS-INCLUDE-STRINGO
D20FOR$INCLUDEFILENAMELED20FOR$INCLUDEASSOCLISTED20FOR$INCLUDEFILEI
D20FOR$CHARACTER-CONSTANTNPRD20FOR$INCLUDEFILE-PRINTD20FOR$CHARACTER-CONSTANT-PRINTPRD20FOR$PEEK-AT-NEXT-INPUT-CHARTPRD20FOR$CURRENT-INPUT-STRING-LENGTH
D20FOR$NEXT-STMT-CHARTRI	D20FOR$INSIDE-STRINGGTHD20FOR$END-OF-FILED20FOR$INPUT-LINE-LENGTHFILNOTFNDCould not find input file: %wFORPILEP> Bx@@C,p=   x D 
,p@  ,pD 
,pA  ,pD ,pC B,k'3B+-w . ,l B
+.,,pB+.,jT3B+.,.'3B+. . ,l B
+.  .
 .
,s% . ,pD . ,pD . ,pF  Ba>~,~<-a-b-f-g<2 
+l#> Bx  x,sm x ,sn B2B+.@@ x B8  x D8 x 
C L8 x 
a L8 x 
B L8 x>,~TOOLONGESLine too long; characters after column 72 ignored> Bx@@  D 
,lZB1B,jR2B+.1 .
2L.T+.M 
0L+.:3@r+.6@@ ,sH2@

9L,ji BB +.S 
0LB+.F .
3L.T+.F .
2L.T+.B +.D 
,l B+.> .U .U .T,s% C,ji BC B,ji BB3@r+.L x,k6 C,sH +.S   xd"p:l" df ,ji B+.)>~,~<..!".[!.\.]LOT.^2<@1._<@.].`.a.b<@> Bx  B x,sm x2@8+/Z 
9@@ B D~Z$# ,jg2B+.v  x 8d"p:l" d" B~ /],k3B+.t 
9+.u  B~2B+.w ~+.y ,ji B+.j2B+.{ 
x6@0+.} /] x B8+/Z   x @@ B D~ F~ H}Z$# ,jg2B+/ 
0L+/2@}+/ 
9+/  ~d"p:l" d" B} /\,k3B+/ 

9 L} 
9+/ 
}0L+/ 
9+/ 
}0L+/ 

9 L~ 2B+/ ~+/ ,ji B+/3B+/ x  x B8+/Z@@ x 8d"p:l" d"0B+/8Z$ x 8d"p:l" d"Z$,j~2B+/3Z$ x 8d"p:l" d"Z$,jg2B+/3 x 

9 L8 xZ, L8Z" x B8+/Z x 

9 L8 xZ, L8Z" x B8+/Z@@ x 8d"p:l" d" /\,k3B+/BZ&BZ$ x ,jE x B8+/Z@@ x 8d"p:l" d" /[,k3B+/X3@w+/OZ&@@ x 8d"p:l" df 
9 x B8+/ZZ&!@@ x 8d"p:l" dfZ&BZ$ x ,jE x B8+/Z 
9x@B8+/Z>>|,~.V.W.X.Y.Z,>3@
C L8  x B8 
9 x B8+/h>+sq>,~> BxZ"B,k @@ B D  ,jg3B+/q +/xZ&  x 8d"p:l" df ,ji B+/n x@@8 x@@8 xZ, L8 x@@8  x B8  x D8  x F8  x H8  x B8>~,~INVCHRCNFAn invalid character (%w) was found in the continuation field.ngINVCHRLBFAn invalid character (%w) was found in the label field.e li> Bx,so x@@8 x2@8+0JZ$ x ,j~3B+0JZ$ x ,jg3B+0! +0J x  x 8d"p:l" d" B B 
0L+0.Z$ x ,j{ Z",jh  x ,jj,ji+00 x ,ji B~ x B8 x ,ji B~ x B8  BZ$,j~2B+0AZ$ ,jg2B+0A x Z",ji BZ$ ,jh  ,jj x B8+0 
1L+0 
1L+0 
1L+0 ,sS  0v,j>  0u 0u,s%+0 x2@8+0r x 80N+0r x  x 8d"p:l" d" B B 
0L+0[Z$ x ,j{ Z",jh  x ,jj+0\ x ,ji x B8 x ,ji x B8  BZ$,jg3B+0h 
1L+0h  x D8 x 

9 L8+0r 
1L+0r 
1L+0r 
1L+0r 
1L+0r0,sS00t,j>00t0u,s%x>~,~00<0
,k9 ,j< B C,j| B g,k9 ,j< B  Dg  
l Lx620V+1
 x +1 B D F~620V+1  B~621V+1 +1 
93B+1 ~ 3BB+1 +1 
92B+1 +1* l  l  Dl3@~+1# ,jG ~ B8 ~  B~+1% ,jG B~ B x  Dx620V+1) +1)  B+1 ,j< B 2	,j| B3@
9@@ Bx DZ$# x,jg2B+1< x ? d"p:l" d" B 2	,k3B+1: 
9+1;  B2B+1= +1? x,ji Bx+102B+1D ?@@ ,k9 ,j< B A ,k @@ Bx D  x,jg3B+1K +1QZ& x A  d"p:l" df x,ji Bx+1G 
9@@ Bx DZ$# x,jg2B+1_ x A d"p:l" d" B 2	,k3B+1] 
9+1^  B2B+1` +1b x,ji Bx+1S2B+2   A @@ Bx D F H~Z$# x,jg2B+1| 
x0L+1n2@~+1n 
9+1{ x d"p:l" d" B~ 2,k3B+1v 

9 L~ 
9+1{ 
~0L+1x 
9+1{ 
~0L+1{ 

9 L 2B+1} +1 x,ji Bx+1h2B+2 A,k9,sr ,j< B A,sm h,ji Bh>},~<x<<0v0w<
2<@> Bx@@ BZ$# ,jg2B+2  x 8d"p:l" d" 2',k2B+2 +2 ,ji B+2  B  x 8d"p:l" d"0B+2$Z&  x 8d"p:l" df x@@8 x>,~2
ENDINCLUDESE-Reading resumed from file '%w'.und>      D Bx62Z0V+24 +25  B62[1V+28 +2A  
BL8l,j< Bl x  Dx62[0V+2? +2@  B+25     D Bg   D BC h,k Bh     D B
   D BaZ$ w,j~2B+2Y B,k-4kN	2 a,pA  2],j>  2\ 2\,sQ-4kP+2Y >,~<<x<<2'2)> Bx @ @,j< B~  
~ L~630V+2e ~ +2f    B} D} F|630V+2k 
}0L+2l }+2z 
}1L+2u3@|+2s },jG | B8 |  B|+2u },jG B| B} ~  B~630V+2y +2y  B}+2h,j: B  
~ L~630V+3 ~ +3     B} D} F| H|631V+3 |+32@}+3
 
}0L+3
 
9 B}+3 3B+33@|+3 },jG | B8 |  B|+3 },jG B| B| ~  B~630V+3 +3  B}+3,st B >{,~<~</NOLISTON/LIST$CON> Bx2B+3" 3H+3E  B x  B63F0V+3' +3(    B D~ F~63F0V+3- 
0L+3. ~+3;3@~+33 ,jG ~ B8 ~  B~+35 ,jG B~ B~   D63G0V+39 +3:  B+3*Z$,j|,j: B 3H,jS2B+3A 3G ,jS3B+3B +3E x Z",k+3 >},~<<<33>,j< Bx ,j<  x,jI>+j:FOR> Bx,p= B,pB 3\,jS2B+3Y ,pB B ,pB  ,jI  ,pE v ,pF >~+pC3NNCLU> Bx,q x,st B,p= B 3n,pD 3n ,pD 3n ,pF ,pC B~,sv B ~,j| ,j< B ,sv B~>}+su3]READINCIO
ReadingINCLUDEfile,'%w'NES>,sx,Bx,sr x  ,sv x 8 B8 B,k BBZ$ w,j~2B+4  4,j>  4 4,sQ ,sk@@C  B
,sl  
42L8+4sDB? 
43L+4 BA   D B?6@+4 
BLs  D  B
+sy  
,j~3B+4$ 
 d"p+4& A  A d"p:l" d",~ ` 
A L` 
? LA B?+spBUGCHECKSInternal Error #2UT> A  A d"p:l" d"0B+4]  
,jT2B+4< 4p 4p 4o,s%+4\ A  A d"p:l" d" Bx B 
x0L+4JZ$ A ,j{ Z",jh  A ,jj,ji+4L A ,ji B A B ,ji B A B @@ Bx D  x,jg3B+4U +4[Z& x d"p:l" df x,ji Bx+4Q@@@@
 A@@+4k  DH @@ Bx D  x,jg3B+4d +4jZ& x d"p:l" df x,ji Bx+4`@@@@
,s! A3@+4n +4n 
9>~,~<4-4.> A  A d"p:l" d"0B+4y2@+4yO@+5D A  A d"p:l" d"1B+5Z$# A ,jg3B+5 A2@+5  A d"p:l" d"0B+5 A 

9 L ,jiZ&$  A ,jE,s$ H,j< BH ?3@+5,s!+4r3@+5 B   5E,jn Bx ? ,s$  x 5E,jf E,j< BE ?,sp+4rO@+5D3@+51 A  A d"p:l" d" Bx B 
x0L+5+Z$ A ,j{ Z",jh  A ,jj+5, A ,ji A B ,ji A B +5D A  A d"p:l" d" Bx B 
x0L+5>Z$	A	,j{CZ",jhe Ar,jj+5?UAR,jiaAcBc,jiiAeB . co>  
,j~3B+5Z 
 d"p:l" d" Bx 
,ji B
 x+5w  
,jR3B+5t3@+5_,s{+5k  Bx,s{ Bx1B+5e1B+5e1B+5e +5j2B5x+5`,sS  5{,j>  5{ 5z,s%+5` x Bx3B5x+5w  
 d"p:l" df 
,ji B
 ,ji B x+5w 5z 5y 5y,s%O@>,~{<5F5G<5J5K,p~2B6+5 
9,~ ,~<

<@<
	<@<|<@<	9<@<
<@?{{{{{{{{{{{{{{{{{{{{{{{{{{{{{ !!""##$$%%&&''(())**++,,-{{{/{{ !!""##$$%%&&''(())**++,,-{{{{{<	}<@<	h<@<	2<@<	4<@<	c<@<	0<@<	2<@<	P<@<
<@<
<@<	X<@<	<@<
<@<	5<@<	1<@<	]<@<	z<@<	g<@<	g<@<	W<@<	~<@<
<@<	{<@<	R<@INT2STRINGDE-SSTRING2INTDE-SD20FOR$TOPLEVEL-1-DEFAULT-PRINTSSIIDENTIFIERESS-D20FOR$ID-PRINTRKD20FOR$INTEGER-CONSTANTNINTEGER-CONSTANTPSD20FOR$INTEGER-CONSTANT-PRINTD20FOR$UNSIGNED-INTEGER-CONSTANT-PRINTe
D20FOR$OCTAL-CONSTANT-TOOCTAL-CONSTANTGITCO
D20FOR$DATA-OCTAL-CONSTANTTD20FOR$DATA-OCTAL-CONSTANT-PRINTD20FOR$OCTALDIGIT-PRINTD20FOR$HEXADECIMALDIGITCD20FOR$DATA-HEXADECIMAL-CONSTANTPRD20FOR$DATA-HEXADECIMAL-CONSTANT-PRINTD20FOR$HEXADECIMALDIGIT-PRINTCHARACTER-CONSTANTS
D20FOR$HOLLERITH-CONSTANTENTHOLLERITH-CONSTANTSD20FOR$HOLLERITH-CONSTANT-PRINTPRD20FOR$STATEMENT-LABEL-CONSTANTPRSTATEMENT-LABEL-CONSTANTD20FOR$STATEMENT-LABEL-CONSTANT-PRINTeLEADING-DECIMALT-CHD20FOR$DECIMAL-CONSTANTT	D20FOR$DOT-OPERATORDOUBLE-CONSTANTPSREAL-CONSTANTND20FOR$DECIMAL-CONSTANT-PRINTD20FOR$SIGNED-DECIMAL-CONSTANTTRI-FAILDECD20FOR$COMPLEX-CONSTANTNCOMPLEX-CONSTANTPSFAILD20FOR$COMPLEX-CONSTANT-PRINTD20FOR$RESTUFFD20FOR$REST-PRINTCH%wMS  7[+j>7X> Bx@@ B x 
8$7qbD7rn7r@@ B D~ ~ ,jg3B+7f +7pZ$ ,ji B~  xd"p:l" d"Z$,jh  ~,jj B ,ji B+7b>},~x> Bx 
$8bD8n8@@ B D  ,jg3B+7{ 
9+8 ,ji B  xd"p:l" d"   d"p:l" df ,ji B+7x>~,~xAME> 
  8/ Bx F,p~ B3B8.+8+Z$ ,j~2B+8+Z$- ,jg2B+8+ 
3L8.+8Z$  ,j~2B+8Z$- ,jg3B+8 Z$ ,j~2B+8Z$ ,jg3B+8  +8% @@,k;  x,jI Bx,p~ B+8 
3L8.+8( 
,k B
 x,l	  8/>~+jm 
 L
 8.>~,~<~<
8	> Bx,jG  B D2@+85 +8m     D  B~ D~   D} D}  B|3B+8> +8? 
92B+8B 
968o1V+8B 3B+8P   D}3B8q+8G +8G 
93B+8P3D+8M  B|  D} B~ 
9+8M 3B+8P 
93D+8P 3B+83 ~,j7 B},j< Z"/,k3B+8Y } 
8"8obB8pn8p+8\ } 
8$8obD8pn8pZ",j @@ B} D| | },jg2B+8l ,ji B } }d"p:l" d"   d"p:l" df },ji B}+8^ 

9 L+83 >|,~<|x<
ALUE> 
  9 Bx F,p~ B0B+8y,p~ B+80B+8 @@,k;  x,jI Bx,p~ B3B9+9Z$,j~2B+9Z$ ,jg2B+9 
3L9+9Z$ ,j~2B+9Z$ ,jg3B+9
 +9 @@,k;  x,jI Bx,p~ B+9 
3L9+9 
,k B
 x 9>~+jm 
 L
 9>~,~<~<
8qALUE> 
  9; Bx F,p~ B3B99+97Z$,j~2B+97Z$ ,jg2B+97 
3L99+9,Z$ ,j~2B+9,Z$ ,jg3B+9- +92 @@,k;  x,jI Bx,p~ B+9% 
3L99+95 
,k B
 x 9:>~+jm 
 L
 9:>~,~<~<
9> Bx,jG  B D2@+9A +9p     D  B~ D~   D} D}  B|3B+9J +9J 
92B+9N 
969q1V+9N 3B+9\   D}3B9s+9R +9S 
93B+9\3D+9X  B|  D} B~ 
9+9Y 3B+9\ 
93D+9\ 3B+9? ~ 
8$9rbD9rn9s@@ B} D} } },jg2B+9n ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+9a 

9 L+9? >|,~<|x<
+tALUE> 
  : Bx F,p~ B3B:+:0B+:0B+:,p~ B 
3L:+:Z$ ,j~2B+:Z$ ,jg3B+: +: @@,k;  x,jI Bx,p~ B+9~ 
3L:+: 
,k B
 x :,jm+: 
 L
 :+: 
 L
 :>~,~<~<
9u> Bx,jG  B D2@+: +:j     D  B~ D~   D} D}  B|3B+:% +:% 
92B+:) 
96:k1V+:) 3B+:7   D}3B:m+:- +:. 
93B+:73D+:3  B|  D} B~ 
9+:4 3B+:7 
93D+:7 3B+:@@ ~d"p:l" d"0B+:B ,ji BZ&  d"p:l" df ,ji BZ&  d"p:l" df ~ 
8$:lbD:ln:m@@ B} D} } },jg2B+:] } ~d"p:l" d"1B+:[ ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+:K ,ji BZ&  d"p:l" df ,ji BZ&'  d"p:l" df 

9 L+: >|,~<|x<
'0FO<>:qO'TE:r<@<=:s<
<@> 
 Bx ;,kj B2@	+; ;,kj B2@	+; ,jG 
 B~ D~   ;,pw ~ ~ ;,pw ~ ~ ;,pv ~ ~ ;,pw ~  B~ ,kk ~3B;+;  ;,kh+;
 
x L
 
x L
 ; B ,kk >},~<~:n:o<
:p<<}'0FO<>;O'TE;<@<=;<
<@> Bx  B ;H,kj B2@	+;D ;H,kj B~2@	+;>6;E1V+;%  ;H,kh  B~ x B}  B} ;G  ~ ;G,p}3B+;. }  D}  F} } ~ ;G,p|3B+;3 }  D}  F} } } ~ ;F,p{ B}  ;F  ~ ;F,p}3B+;< }   
9 B~ ~,kk ~3B+;A 
9 ;H,kh 
 L  B~ ,kk ~>|,~<x;;<
;<<}7TTE6TTE5TTE4TTE3TTE2TTE1TTE0TTE> 
 Bx <R,kj B2@	+<L <Q,kj B2@	+;_ ,jG 
 B~ D~   <Q,pw ~  B~ ,kk ~3B<P+;b  <R,kh+;c 
x L
 <Q,kj B2@	+;m ,jG 
 B~ D~   <P,pw ~  B~ ,kk ~ B3B<P+;q  <R,kh+;r 
x L
 <Q,kj B2@	+;| ,jG 
 B~ D~   <O,pw ~  B~ ,kk ~ B3B<P+;  <R,kh+< 
x L
 <Q,kj B2@	+<
 ,jG 
 B~ D~   <O,pw ~  B~ ,kk ~ B3B<P+<  <R,kh+< 
x L
 <Q,kj B2@	+< ,jG 
 B~ D~   <N,pw ~  B~ ,kk ~ B3B<P+<  <R,kh+< 
x L
 <Q,kj B2@	+<' ,jG 
 B~ D~   <N,pw ~  B~ ,kk ~ B3B<P+<+  <R,kh+<, 
x L
 <Q,kj B2@	+<6 ,jG 
 B~ D~   <M,pw ~  B~ ,kk ~ B3B<P+<9  <R,kh+<: 
x L
 <Q,kj B2@	+<D ,jG 
 B~ D~   <M,pw ~  B~ ,kk ~3B<P+<G  <R,kh+<H 
x L
 
x L
 <P B ,kk >},~;I;J;K;L;M;N;O<~;P<<}7TTE6TTE5TTE4TTE3TTE2TTE1TTE0TTE> Bx  B =|,kj B2@	+=v =|,kj B~2@	+<o6=w1V+<e  =|,kh  B~ x B}  ={  ~ ={,p}3B+<m }  D}  
9 B~ ~,kk ~3B+<r 
9 =|,kh =|,kj B~2@	+=6=w1V+<w  =|,kh  B~ x B}  ={  ~ ={,p}3B+< }  D}  
9 B~ ~,kk ~3B+= 
9 =|,kh =|,kj B~2@	+=6=w1V+=
  =|,kh  B~ x B}  =z  ~ =z,p}3B+= }  D}  
9 B~ ~,kk ~3B+= 
9 =|,kh =|,kj B~2@	+='6=w1V+=  =|,kh  B~ x B}  =z  ~ =z,p}3B+=$ }  D}  
9 B~ ~,kk ~3B+=) 
9 =|,kh =|,kj B~2@	+=96=w1V+=/  =|,kh  B~ x B}  =y  ~ =y,p}3B+=7 }  D}  
9 B~ ~,kk ~3B+=< 
9 =|,kh =|,kj B~2@	+=L6=w1V+=A  =|,kh  B~ x B}  =y  ~ =y,p}3B+=I }  D}  
9 B~ ~,kk ~3B+=N 
9 =|,kh =|,kj B~2@	+=^6=w1V+=T  =|,kh  B~ x B}  =x  ~ =x,p}3B+=\ }  D}  
9 B~ ~,kk ~3B+=a 
9 =|,kh =|,kj B~2@	+=p6=w1V+=f  =|,kh  B~ x B}  =x  ~ =x,p}3B+=n }   
9 B~ ~,kk ~3B+=s 
9 =|,kh 
 L  B~ ,kk ~>},~<x<R<S<T<U<V<W<X<Y<<}'0FO<>>Z'TE><@<=><
<@> 
 Bx >#,kj B2@	+> >",kj B2@	+> ,jG 
 B~ D~   >",pw ~ ~ >!,pw ~ ~ >!,pv ~ ~ > ,pw ~  B~ ,kk ~3B> +>  >#,kh+> 
x L
 
x L
 >  B ,kk >},~<~=}=~<
=<<}'0FO<>>&Z'TE>'<@<=>(<
<@> Bx  B >W,kj B2@	+>S >W,kj B~2@	+>M6>T1V+>4  >W,kh  B~ x B}  B} >V  ~ >V,p}3B+>= }  D}  F} } ~ >V,p|3B+>B }  D}  F} } } ~ >U,p{ B}  >U  ~ >U,p}3B+>K }   
9 B~ ~,kk ~3B+>P 
9 >W,kh 
 L  B~ ,kk ~>|,~<x>#>$<
>%<<}FTTEETTEDTTECTTEBTTEATTE9TTE8TTE7TTE6TTE5TTE4TTE3TTE2TTE1TTE0TTE> 
 Bx @a,kj B2@	+@W @`,kj B2@	+>v ,jG 
 B~ D~   @`,pw ~  B~ ,kk ~3B@_+>y  @a,kh+>z 
x L
 @`,kj B2@	+? ,jG 
 B~ D~   @_,pw ~  B~ ,kk ~ B3B@_+?  @a,kh+?	 
x L
 @`,kj B2@	+? ,jG 
 B~ D~   @^,pw ~  B~ ,kk ~ B3B@_+?  @a,kh+? 
x L
 @`,kj B2@	+?! ,jG 
 B~ D~   @^,pw ~  B~ ,kk ~ B3B@_+?%  @a,kh+?& 
x L
 @`,kj B2@	+?0 ,jG 
 B~ D~   @],pw ~  B~ ,kk ~ B3B@_+?3  @a,kh+?4 
x L
 @`,kj B2@	+?> ,jG 
 B~ D~   @],pw ~  B~ ,kk ~ B3B@_+?B  @a,kh+?C 
x L
 @`,kj B2@	+?M ,jG 
 B~ D~   @\,pw ~  B~ ,kk ~ B3B@_+?P  @a,kh+?Q 
x L
 @`,kj B2@	+?[ ,jG 
 B~ D~   @\,pw ~  B~ ,kk ~ B3B@_+?_  @a,kh+?` 
x L
 @`,kj B2@	+?j ,jG 
 B~ D~   @[,pw ~  B~ ,kk ~ B3B@_+?m  @a,kh+?n 
x L
 @`,kj B2@	+?x ,jG 
 B~ D~   @[,pw ~  B~ ,kk ~ B3B@_+?|  @a,kh+?} 
x L
 @`,kj B2@	+@ ,jG 
 B~ D~   @Z,pw ~  B~ ,kk ~ B3B@_+@
  @a,kh+@ 
x L
 @`,kj B2@	+@ ,jG 
 B~ D~   @Z,pw ~  B~ ,kk ~ B3B@_+@  @a,kh+@ 
x L
 @`,kj B2@	+@$ ,jG 
 B~ D~   @Y,pw ~  B~ ,kk ~ B3B@_+@'  @a,kh+@( 
x L
 @`,kj B2@	+@2 ,jG 
 B~ D~   @Y,pw ~  B~ ,kk ~ B3B@_+@6  @a,kh+@7 
x L
 @`,kj B2@	+@A ,jG 
 B~ D~   @X,pw ~  B~ ,kk ~ B3B@_+@D  @a,kh+@E 
x L
 @`,kj B2@	+@O ,jG 
 B~ D~   @X,pw ~  B~ ,kk ~3B@_+@R  @a,kh+@S 
x L
 
x L
 @_ B ,kk >},~>X>Y>Z>[>\>]>^>_>`>a>b>c>d>e>f<~>g<<}FTTEETTEDTTECTTEBTTEATTE9TTE8TTE7TTE6TTE5TTE4TTE3TTE2TTE1TTE0TTE> Bx  B C+,kj B2@	+C! C+,kj B~2@	+A6C"1V+@|  C+,kh  B~ x B}  C*  ~ C*,p}3B+A }  D}  
9 B~ ~,kk ~3B+A	 
9 C+,kh C+,kj B~2@	+A6C"1V+A  C+,kh  B~ x B}  C*  ~ C*,p}3B+A }  D}  
9 B~ ~,kk ~3B+A 
9 C+,kh C+,kj B~2@	+A+6C"1V+A!  C+,kh  B~ x B}  C)  ~ C),p}3B+A) }  D}  
9 B~ ~,kk ~3B+A. 
9 C+,kh C+,kj B~2@	+A>6C"1V+A3  C+,kh  B~ x B}  C)  ~ C),p}3B+A; }  D}  
9 B~ ~,kk ~3B+A@ 
9 C+,kh C+,kj B~2@	+AP6C"1V+AF  C+,kh  B~ x B}  C(  ~ C(,p}3B+AN }  D}  
9 B~ ~,kk ~3B+AS 
9 C+,kh C+,kj B~2@	+Ac6C"1V+AX  C+,kh  B~ x B}  C(  ~ C(,p}3B+A` }  D}  
9 B~ ~,kk ~3B+Ae 
9 C+,kh C+,kj B~2@	+Au6C"1V+Ak  C+,kh  B~ x B}  C'  ~ C',p}3B+As }  D}  
9 B~ ~,kk ~3B+Ax 
9 C+,kh C+,kj B~2@	+B6C"1V+A}  C+,kh  B~ x B}  C'  ~ C',p}3B+B }  D}  
9 B~ ~,kk ~3B+B
 
9 C+,kh C+,kj B~2@	+B6C"1V+B  C+,kh  B~ x B}  C&  ~ C&,p}3B+B }  D}  
9 B~ ~,kk ~3B+B 
9 C+,kh C+,kj B~2@	+B-6C"1V+B"  C+,kh  B~ x B}  C&  ~ C&,p}3B+B* }  D}  
9 B~ ~,kk ~3B+B/ 
9 C+,kh C+,kj B~2@	+B?6C"1V+B5  C+,kh  B~ x B}  C%  ~ C%,p}3B+B= }  D}  
9 B~ ~,kk ~3B+BB 
9 C+,kh C+,kj B~2@	+BR6C"1V+BG  C+,kh  B~ x B}  C%  ~ C%,p}3B+BO }  D}  
9 B~ ~,kk ~3B+BT 
9 C+,kh C+,kj B~2@	+Bd6C"1V+BZ  C+,kh  B~ x B}  C$  ~ C$,p}3B+Bb }  D}  
9 B~ ~,kk ~3B+Bg 
9 C+,kh C+,kj B~2@	+Bw6C"1V+Bl  C+,kh  B~ x B}  C$  ~ C$,p}3B+Bt }  D}  
9 B~ ~,kk ~3B+By 
9 C+,kh C+,kj B~2@	+C	6C"1V+B  C+,kh  B~ x B}  C#  ~ C#,p}3B+C }  D}  
9 B~ ~,kk ~3B+C
 
9 C+,kh C+,kj B~2@	+C6C"1V+C  C+,kh  B~ x B}  C#  ~ C#,p}3B+C }   
9 B~ ~,kk ~3B+C 
9 C+,kh 
 L  B~ ,kk ~>},~<x@a@b@c@d@e@f@g@h@i@j@k@l@m@n@o@p<<}ALUE> 
  CT 
9 Bx D H~,p~ B3BCS+CP0B+CP 
9  B~-4kN
2@x+C9 +CJ,p~ B2BCS+C= 

9 L~  Dx+C70B+CF,sz B0B+CE @@,k;  ,jI B,p~+C7  Dx+C7 @@,k;  ,jI B+C73@~+CM 
~ L
 CT+CO  CS,jm-4kP+CR 
~ L
 CT>},~<
<~C,> Bx,jG  B D2@+CZ +D"     D  B~ D~   D} D}  B|3B+Cc +Cd 
92B+Cg 
96D#1V+Cg 3B+Cu   D}3BD%+Cl +Cl 
93B+Cu3D+Cr  B|  D} B~ 
9+Cr 3B+Cu 
93D+Cu 3B+CX ,ji BZ&  d"p:l" df ~ 
8$D$bDD$nD%@@ B} D} } },jg2B+D } ~d"p:l" d"0B+D ,ji B } ~d"p:l" d"   d"p:l" df ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+D ,ji BZ&  d"p:l" df 

9 L+CX >|,~<|x<
ALUE>  DG B  B 
 B~,s6 Bx2BDG+D/ 
~ L
 DG+DE,p~ B1B$+D3 
~ L
 DG+DE 
9-4kN
 x  ,s~ Z" B~ D} } ~,jg3B+D< +DC,p~ B @@,k;  ,jI B ~,ji B~+D9-4kP  DF,jm>},~<
<~D&> Bx,jG  B D2@+DM +E     D  B~ D~   D} D}  B|3B+DV +DW 
92B+DZ 
96E1V+DZ 3B+Dh   D}3BE+D_ +D_ 
93B+Dh3D+De  B|  D} B~ 
9+De 3B+Dh 
93D+Dh 3B+DK ~ 
8"EbBEnE,ji,s} B} 
$EbDEnE@@ B} D| | },jg2B+D~ ,ji B } }d"p:l" d"   d"p:l" df },ji B}+Dq ,ji BZ&$  d"p:l" df ~ 
8$EbDEnE@@ B} D} } },jg2B+E ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+E 

9 L+DK >|,~<|x<
> 
   Fx,p~1B+E#1B+E#1B+E# 
x L
 E++E),t2BE++E' 
x L
 E++E)   E*>+jm>,~<
<~> Bx,jG  B D2@+E1 +Ee     D  B~ D~   D} D}  B|3B+E: +E: 
92B+E> 
96Eg1V+E> 3B+EL   D}3BEi+EB +EC 
93B+EL3D+EH  B|  D} B~ 
9+EI 3B+EL 
93D+EL 3B+E/ ,ji BZ&  d"p:l" df ~ 
8$EgbDEhnEh@@ B} D} } },jg2B+Ed ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+EV 

9 L+E/ >|,~<|x<
.T1<
EkEl<@EADI>   B  B 
 B~,s6 B~,p~ Bx 
~2LF3+Ew0B+Ew 
F3 L~1B$+Ez 
~2LF3+E| 
~ L
 F3+F/ 
-4kN|,t
2BF3+F +F 
9-4kP3B+FZ, Lx ~ 
F22L8+F 
F3 L~ 
x0L+F,t B2BF3+F ~ 
F22L8+FF2+F   F2,jI  ~  ,jI  F1,jm B~,p~ Bx 
~2LF3+F 
~ L
 F3+F/ 
x0L"+F F1+F 
x0L"+F F1+F  B3B+F,,t B2BF3+F$ 
,k B
+F/ x,jG,k>   ,jI  ~  ,jI  ,jm+F/ 
x3LF0+F/ 
,k B
 ~>},~<
<
Ei<
Ej<~> Bx,jG  B D2@+F9 +G@     D  B~ D~   D} D}  B|3B+FB +FC 
92B+FF 
96GB1V+FF 3B+FT   D}3BGE+FK +FK 
93B+FT3D+FQ  B|  D} B~ 
9+FQ 3B+FT 
93D+FT 3B+Fh ~ 
8$GBbDGCnGC@@ B} D} } },jg2B+Fg ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+FY 

9 L+F7 ~  B} D} D}  B|3B+Fn +Fn 
92B+Fr 
96GB1V+Fr 3B+G  B|  D}3BGD+Fw +Fw 
93B+G3D+F}  B|  D} B~ 
9+F} 3B+G 
93D+G 3B+G ~ 
8$GBbDGCnGC@@ B} D} } },jg2B+G ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+G 

9 L+F7 ~  B} D} D}  B|3B+G +G 
92B+G 
96GB1V+G 3B+G,  B|  D}3BGD+G# +G# 
93B+G,3D+G)  B|  D} B~ 
9+G) 3B+G, 
93D+G, 3B+F7 ~ 
8$GBbDGCnGC@@ B} D} } },jg2B+G? ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+G1 

9 L+F7 >|,~<|x<
<
<
-NCA>,p~   
 Bx1D+GV0D+GS,t B3BG[+GR   G[,jI   ,jm+GV G[+GV3DGZ+GV 
,k B
,t2BGZ+GY 
x L
 G[>,~<
GE<~(RY-,PR1)PR2> @x @ 

 L,p~0B+Gp,t  Dx2DH+Gh,t  Fx3FG+Gp,p~0B+Gp,t  D2DH+Go,t  F3FG+Gp,p~1B+Gr 
 L
 H+G| G   ,jI  G~,jI  x  ,jI  G~,jI  G}>~+jm>~,~<
G\G]G^<
<~> Bx,jG  B D2@+H +H5     D  B~ D~   D} D}  B|3B+H +H 
92B+H 
96H61V+H 3B+H!   D}3BH8+H +H 
93B+H!3D+H  B|  D} B~ 
9+H 3B+H! 
93D+H! 3B+H ~ 
8$H7bDH7nH8@@ B} D} } },jg2B+H3 ,ji B } ~d"p:l" d"   d"p:l" df },ji B}+H& 

9 L+H >|,~<|x<
TRO>HF D,p~ Bx2BHE+H? +HC @@,k;  ,jI B+H<  HF>+jm<
$HabDHanHb3DHb+H_  B 
$HabDHanHb@@ B D~ ~ ,jg3B+HT +H_ ,ji B  d"p:l" d"   d"p:l" df ,ji B+HQ 
9>~,~x<
<@<|<@<{<@<<@
D20FOR$UNIT-SPECIFIERTH
D20FOR$UNIT1-SPECIFIERSS	D20FOR$REC-SPECIFIERRESS
D20FOR$REC-SPECIFIER-PRINT	D20FOR$UNIT-AND-REC
D20FOR$UNIT-AND-REC-PRINT	D20FOR$FMT-SPECIFIERRESS
D20FOR$FMT-SPECIFIER-PRINT
D20FOR$FMT1-SPECIFIERION	D20FOR$END-SPECIFIERSION
D20FOR$END-SPECIFIER-PRINT	D20FOR$ERR-SPECIFIERNTN
D20FOR$ERR-SPECIFIER-PRINT	D20FOR$IOS-SPECIFIERNTN
D20FOR$IOS-SPECIFIER-PRINT	D20FOR$IO-LIST-ITEMD20FOR$IO-LIST	D20FOR$IO-LIST-PRINT
D20FOR$IO-LIST-ITEM-PRINT*IT=ITUNIT> 
 Bx I_,kj B2@	+I[ I^,kj B2@	+IA ,jG 
 B~ D~   I^,pw ~ ~ I],pw ~ ~ I],pw ~  B~ ,kk ~3BI\+ID  I_,kh+IE 
x L
 I^,kj B2@	+IS ,jG 
 B~ D~   I^,pw ~ ~ I],pw ~ ~ I\,pw ~  B~ ,kk ~3BI\+IV  I_,kh+IW 
x L
 
x L
 I\ B ,kk >},~<	C<~I,I-I.<<}*IT=ITUNIT> Bx  B J,,kj B2@	+J( J+,kj B~2@	+J6J)1V+Im  J+,kh  B~ x B}  B} J+  ~ J+,p}3B+Iv }  D}  F} J* } ~ J*,p}3B+I| }  D}  F} J* } ~ J*,p}3B+J }  D}  
9 B~ ~,kk ~3B+J 
9 J,,kh J+,kj B~2@	+J"6J)1V+J
  J+,kh  B~ x B}  B} J+  ~ J+,p}3B+J }  D}  F} J* } ~ J*,p}3B+J }  D}  F} } ~ J),p|3B+J }   
9 B~ ~,kk ~3B+J$ 
9 J,,kh 
 L  B~ ,kk ~>|,~<x<	CI_I`Ia<<}*IT=ITUNIT> 
 Bx Jn,kj B2@	+Jj Jm,kj B2@	+JB ,jG 
 B~ D~   Jm,pw ~ ~ Jl,pw ~ ~ Jl,pw ~  B~ ,kk ~3BJk+JE  Jn,kh+JF 
x L
 Jm,kj B2@	+JT ,jG 
 B~ D~   Jm,pw ~ ~ Jl,pw ~ ~ Jk,pw ~  B~ ,kk ~ B3BJk+JW  Jn,kh+JX 
x L
 Jm,kj B2@	+Jb ,jG 
 B~ D~   Jk,pw ~  B~ ,kk ~3BJk+Je  Jn,kh+Jf 
x L
 
x L
 Jk B ,kk >},~<	C<~J,J-J.<<}*IT=ITUNIT> Bx  B KM,kj B2@	+KI KL,kj B~2@	+K6KJ1V+J|  KL,kh  B~ x B}  B} KL  ~ KL,p}3B+K }  D}  F} KK } ~ KK,p}3B+K }  D}  F} KK } ~ KK,p}3B+K }  D}  
9 B~ ~,kk ~3B+K 
9 KM,kh KL,kj B~2@	+K16KJ1V+K  KL,kh  B~ x B}  B} KL  ~ KL,p}3B+K$ }  D}  F} KK } ~ KK,p}3B+K* }  D}  F} } ~ KJ,p|3B+K/ }  D}  
9 B~ ~,kk ~3B+K4 
9 KM,kh KL,kj B~2@	+KC6KJ1V+K9  KL,kh  B~ x B}   ~ KJ,p|3B+K@ }   
9 B~ ~,kk ~3B+KE 
9 KM,kh 
 L  B~ ,kk ~>|,~<x<	CJnJoJp<<}=CERECE> 
 Bx Km,kj B2@	+Ki Kl,kj B2@	+Kb ,jG 
 B~ D~   Kl,pw ~ ~ Kk,pw ~ ~ Kk,pw ~  B~ ,kk ~3BKj+Ke  Km,kh+Kf 
x L
 
x L
 Kj B ,kk >},~<~<	CKMKN<<}=CERECE> Bx  B L,kj B2@	+L L,kj B~2@	+L6L1V+Kz  L,kh  B~ x B}  B} L  ~ L,p}3B+L }  D}  F} L } ~ L,p}3B+L	 }  D}  F} } ~ L,p|3B+L
9 B~ ~,kk ~3B+L 
9 L,kh 
 L  B~ ,kk ~>|,~<x<	CKmKn<<}'0FO> 
 Bx L8,kj B2@	+L5 L7,kj B2@	+L- ,jG 
 B~ D~   L7,pw ~ ~ L6,pw ~ ~ L7,pw ~  B~ ,kk ~3BL6+L0  L8,kh+L1 
x L
 
x L
 L6 B ,kk >},~<~L<	C<<}'0FO> Bx  B Lb,kj B2@	+L_ Lb,kj B~2@	+LY6L`1V+LD  Lb,kh  B~ x B}  B}  ~ La,p|3B+LL }  D}  F} La } ~ La,p}3B+LR }  D}  F} } ~ La,p|3B+LW }   
9 B~ ~,kk ~3B+L\ 
9 Lb,kh 
 L  B~ ,kk ~>|,~<xL8<	C<<}NMLE*TE=TEFMTE> 
 Bx M<,kj B2@	+M8 M<,kj B2@	+Ly ,jG 
 B~ D~   M;,pw ~ ~ M;,pw ~ ~ M:,pw ~  B~ ,kk ~3BM:+L|  M<,kh+L} 
x L
 M<,kj B2@	+M ,jG 
 B~ D~   M9,pw ~ ~ M;,pw ~ ~ M:,pw ~  B~ ,kk ~ B3BM:+M  M<,kh+M 
x L
 M<,kj B2@	+M ,jG 
 B~ D~   M;,pw ~ ~ M;,pw ~ ~ M9,pw ~  B~ ,kk ~ B3BM:+M!  M<,kh+M" 
x L
 M<,kj B2@	+M0 ,jG 
 B~ D~   M9,pw ~ ~ M;,pw ~ ~ M9,pw ~  B~ ,kk ~3BM:+M3  M<,kh+M4 
x L
 
x L
 M: B ,kk >},~<	BLc<~LdLeLf<<}NMLE*TE=TEFMTE> Bx  B NI,kj B2@	+NE NI,kj B~2@	+Mb6NF1V+MK  NI,kh  B~ x B}  B} NH  ~ NH,p}3B+MT }  D}  F} NH } ~ NH,p}3B+MZ }  D}  F} NG } ~ NG,p}3B+M` }  D}  
9 B~ ~,kk ~3B+Me 
9 NI,kh NI,kj B~2@	+N6NF1V+Mj  NI,kh  B~ x B}  B} NG  ~ NG,p}3B+Ms }  D}  F} NH } ~ NH,p}3B+My }  D}  F} NG } ~ NG,p}3B+M }  D}  F} 
9 B~ ~,kk ~3B+N 
9 NI,kh NI,kj B~2@	+N!6NF1V+N
  NI,kh  B~ x B}  B} NH  ~ NH,p}3B+N }  D}  F} NH } ~ NH,p}3B+N }  D}  F} } ~ NF,p|3B+N }  D}  F} 
9 B~ ~,kk ~3B+N# 
9 NI,kh NI,kj B~2@	+N?6NF1V+N)  NI,kh  B~ x B}  B} NG  ~ NG,p}3B+N2 }  D}  F} NH } ~ NH,p}3B+N8 }  D}  F} } ~ NF,p|3B+N< }   
9 B~ ~,kk ~3B+NA 
9 NI,kh 
 L  B~ ,kk ~>|,~<x<	BM=M>M?M@<<}NMLE=TEFMTE*TTE> 
 Bx O@,kj B2@	+O< O@,kj B2@	+N\ ,jG 
 B~ D~   O?,pw ~  B~ ,kk ~3BO?+N_  O@,kh+N` 
x L
 O@,kj B2@	+Nn ,jG 
 B~ D~   O>,pw ~ ~ O>,pw ~ ~ O?,pw ~  B~ ,kk ~ B3BO?+Nr  O@,kh+Ns 
x L
 O@,kj B2@	+O ,jG 
 B~ D~   O=,pw ~ ~ O>,pw ~ ~ O?,pw ~  B~ ,kk ~ B3BO?+O  O@,kh+O 
x L
 O@,kj B2@	+O ,jG 
 B~ D~   O>,pw ~ ~ O>,pw ~ ~ O=,pw ~  B~ ,kk ~ B3BO?+O  O@,kh+O 
x L
 O@,kj B2@	+O& ,jG 
 B~ D~   O=,pw ~ ~ O>,pw ~ ~ O=,pw ~  B~ ,kk ~ B3BO?+O)  O@,kh+O* 
x L
 O@,kj B2@	+O4 ,jG 
 B~ D~   O=,pw ~  B~ ,kk ~3BO?+O7  O@,kh+O8 
x L
 
x L
 O? B ,kk >},~<	BNJNKNL<~NM<<}NMLE=TEFMTE*TTE> Bx  B Ps,kj B2@	+Pn Pr,kj B~2@	+OZ6Po1V+OO  Pr,kh  B~ x B}  B} Pr  ~ Pr,p}3B+OX }  D}  
9 B~ ~,kk ~3B+O] 
9 Ps,kh Pr,kj B~2@	+Oz6Po1V+Ob  Pr,kh  B~ x B}  B} Pq  ~ Pq,p}3B+Ok }  D}  F} Pq } ~ Pq,p}3B+Oq }  D}  F} Pr } ~ Pr,p}3B+Ow }  D}  F} 
9 B~ ~,kk ~3B+O| 
9 Ps,kh Pr,kj B~2@	+P6Po1V+P  Pr,kh  B~ x B}  B} Pp  ~ Pp,p}3B+P }  D}  F} Pq } ~ Pq,p}3B+P }  D}  F} Pr } ~ Pr,p}3B+P }  D}  F} 
9 B~ ~,kk ~3B+P 
9 Ps,kh Pr,kj B~2@	+P86Po1V+P!  Pr,kh  B~ x B}  B} Pq  ~ Pq,p}3B+P* }  D}  F} Pq } ~ Pq,p}3B+P0 }  D}  F} } ~ Pp,p|3B+P6 }  D}  F} 
9 B~ ~,kk ~3B+P; 
9 Ps,kh Pr,kj B~2@	+PW6Po1V+P@  Pr,kh  B~ x B}  B} Pp  ~ Pp,p}3B+PI }  D}  F} Pq } ~ Pq,p}3B+PO }  D}  F} } ~ Pp,p|3B+PT }  D}  
9 B~ ~,kk ~3B+PY 
9 Ps,kh Pr,kj B~2@	+Ph6Po1V+P_  Pr,kh  B~ x B}   ~ Pp,p|3B+Pf }   
9 B~ ~,kk ~3B+Pk 
9 Ps,kh 
 L  B~ ,kk ~>|,~<x<	BOAOBOCOD<<}=DEENDE> 
 Bx Q,kj B2@	+Q Q,kj B2@	+Q ,jG 
 B~ D~   Q,pw ~ ~ Q,pw ~ ~ Q,pw ~  B~ ,kk ~3BQ+Q  Q,kh+Q
 
x L
 
x L
 Q B ,kk >},~<~<
PsPt<<}=DEENDE> Bx  B Q?,kj B2@	+Q< Q?,kj B~2@	+Q66Q=1V+Q   Q?,kh  B~ x B}  B} Q>  ~ Q>,p}3B+Q) }  D}  F} Q> } ~ Q>,p}3B+Q/ }  D}  F} } ~ Q=,p|3B+Q3 }   
9 B~ ~,kk ~3B+Q8 
9 Q?,kh 
 L  B~ ,kk ~>|,~<x<
QQ<<}=REERRE> 
 Bx Q_,kj B2@	+Q\ Q_,kj B2@	+QT ,jG 
 B~ D~   Q^,pw ~ ~ Q^,pw ~ ~ Q],pw ~  B~ ,kk ~3BQ]+QW  Q_,kh+QX 
x L
 
x L
 Q] B ,kk >},~<~<
Q@QA<<}=REERRE> Bx  B R
,kj B2@	+R R,kj B~2@	+R6R	1V+Ql  R,kh  B~ x B}  B} R  ~ R,p}3B+Qu }  D}  F} R
 } ~ R
,p}3B+Q{ }  D}  F} } ~ R
,p|3B+R }   
9 B~ ~,kk ~3B+R 
9 R
,kh 
 L  B~ ,kk ~>|,~<x<
Q`Qa<<}=STAIOSTATOS> 
 Bx R,,kj B2@	+R) R,,kj B2@	+R! ,jG 
 B~ D~   R+,pw ~ ~ R+,pw ~ ~ R*,pw ~  B~ ,kk ~3BR*+R$  R,,kh+R% 
x L
 
x L
 R* B ,kk >},~<~<	CR
R<}=STAIOSTATOS> Bx  B RY,kj B2@	+RV RY,kj B~2@	+RP6RW1V+R:  RY,kh  B~ x B}  B} RX  ~ RX,p}3B+RC }  D}  F} RX } ~ RX,p}3B+RI }  D}  F} } ~ RW,p|3B+RM }   
9 B~ ~,kk ~3B+RR 
9 RY,kh 
 L  B~ ,kk ~>|,~<x<	CR-R.<<}<>R[R\<@<=R]R^R_,PEAR`Ra<Rb<
*<@Rc<@ RMA> 
 Bx R,kj B2@	+R| R~,kj B2@	+Rt ,jG 
 B~ D~   R~,pw ~ ~ R},pv ~  B~ ,kk ~3BR}+Rw  R,kh+Rx 
x L
 
x L
 R} B ,kk >},~<~RZ<
*<<}<>SS<@<=SSS,PEASS<S<
*<@S<@ RMA> Bx  B S+,kj B2@	+S( S*,kj B~2@	+S"6S)1V+S  S*,kh  B~ x B}  B}  ~ S*,p|3B+S }  D}  F} } } ~ S),p{  
9 B~ ~,kk ~3B+S$ 
9 S+,kh 
 L  B~ ,kk ~>|,~<xR<
*<<})0FO<>S.(TTES/S0=T*<	CS1S2S3,0FO<	CS4S5<@<>S6S2S7<	C<@> 
 Bx Sg,kj B2@	+Sb Sf,kj B2@	+SG ,jG 
 B~ D~   Sf,pw ~  B~ ,kk ~3BSe+SJ  Sg,kh+SK 
x L
 Sf,kj B2@	+S[ ,jG 
 B~ D~   Se,pw ~ ~ Sd,pw ~ ~ Sd,pv ~ ~ Sc,pw ~  B~ ,kk ~3BSe+S^  Sg,kh+S_ 
x L
 
x L
 Se B ,kk >},~S+S,<
*S-<~<	B<<})0FO<>Sj(TTESkSl=T*<	CSmSnSo,0FO<	CSpSq<@<>SrSnSs<	C<@> Bx  B T5,kj B2@	+T1 T5,kj B~2@	+T	6T21V+S  T5,kh  B~ x B}  B}  ~ T4,p|3B+T }  D}  
9 B~ ~,kk ~3B+T
 
9 T5,kh T5,kj B~2@	+T+6T21V+T  T5,kh  B~ x B}  B} T4  ~ T4,p}3B+T }  D}  F} } ~ T3,p|3B+T  }  D}  F} } } ~ T3,p{ B}  T2  ~ T2,p}3B+T( }   
9 B~ ~,kk ~3B+T- 
9 T5,kh 
 L  B~ ,kk ~>|,~<xSgSh<
*Si<	B<<}<|<@<{<@<<@UNARY-OPEUNARY+OPEUNARYNOTED20FOR$RASSOCE
D20FOR$OPER-PREC-ASSOCHD20FOR$OPEXP-CONVSSD20FOR$OPEXPOD20FOR$AOD20FOR$RUNARYOTOSOUNARY-OPS.NOT.$UNIUNARY-EXPRT-EXBINARY-OPDUMMYCHEBINARY-EXPR-EXPRIMARYPREXPRESSIONPIO**ON//LU==..LT..LE..EQ..GT..GE..NE..AND.$UNI.OR..XOR.UNI.EQV.$UNI.NEQV.UNI<
,Tj<
,Tk<
-<@> Dx =,k B = x,k    B D~ Tz x,k2B+Tx ~ ,jg3B+Ty 
9+Ty >~,~Ti,t  T~ ,j|,t +t!<
0> Bx,jG  B D2@+U +XE     D    B~ D~ F} H}   D| D|  B{3B+U +U 
92B+U 
96XF1V+U 3B+Uk   D|3BXN+U +U 
93B+Uk   D|3BXM+U +U 
93B+Uk6XG0V+UJ  B{  D|   B{ D{ D{  Bz3B+U' +U( 
92B+U+ 
96XG1V+U+ 3B+UK  Bz  D{3BXM+U0 +U1 
93B+UK6XG0V+UG  Bz  D{   Bz Dz Dz  By3B+U; +U; 
92B+U? 
96XH1V+U? 3B+UH3D+UD  By  Dz B~ 
9+UE 3B+UH 
93D+UH 3B+UK 
93@{+UK 3B+Uk6XH0V+Uh |  B{ |  D|   B{ D{ D{  Bz3B+UV +UV 
92B+UZ 
96XG1V+UZ 3B+Uh  Bz  D{3BXL+U_ +U_ 
93B+Uh3D+Ue  Bz  D{ B} 
9+Ue 3B+Uh 
93D+Uh 3B+Uk 
93@|+Uk 3B+Uz 
~2LXL+Uo XK+Ut 
~2LXK+Uq XJ+Ut 
~2LXJ+Ut XI+Ut ,jG  XI,jm }  XL,jf ,j< B+U ~  B| D| D|  B{3B+V +V 
92B+V 
96XF1V+V 3B+VF  B{  D|3BXN+V	 +V	 
93B+VF  B{  D|3BXM+V +V 
93B+VF6XG0V+V<  B{  D|   B{ D{ D{  Bz3B+V +V 
92B+V 
96XG1V+V 3B+V<  Bz  D{3BXM+V" +V" 
93B+V<6XG0V+V9  Bz  D{   Bz Dz Dz  By3B+V, +V- 
92B+V0 
96XH1V+V0 3B+V93D+V6  By  Dz B~ 
9+V6 3B+V9 
93D+V9 3B+V< 
93@{+V< 3B+VF3@|+VC |  B{ |  D| B} 
9+VC 3B+VF 
93@|+VF 3B+VU 
~2LXL+VJ XK+VO 
~2LXK+VL XJ+VO 
~2LXJ+VO XI+VO ,jG  XI,jm }  XL,jf ,j< B+U ~  B| D| D|  B{3B+V[ +V[ 
92B+V_ 
96XF1V+V_ 3B+W!  B{  D|3BXN+Vd +Vd 
93B+W!3D+Vj  B{  D| B} 
9+Vj 3B+W!6XG0V+W  B{  D|   B{ D{ D{  Bz3B+Vt +Vu 
92B+Vx 
96XG1V+Vx 3B+W  Bz  D{3BXM+V} +V~ 
93B+W6XG0V+W  Bz  D{   Bz Dz Dz  By3B+W +W 
92B+W
 
96XH1V+W
 3B+W3D+W  By  Dz B~ 
9+W 3B+W 
93D+W 3B+W 
93@{+W 3B+W! |  B{ |  D|3BXM+W +W 
93B+W! 
93D+W! 3B+W%  },j< B+U ~  B| D| D|  B{3B+W* +W+ 
92B+W. 
96XF1V+W. 3B+WZ  B{  D|3BXL+W3 +W4 
93B+WZ6XG0V+WP  B{  D|   B{ D{ D{  Bz3B+W> +W> 
92B+WB 
96XG1V+WB 3B+WP  Bz  D{3BXI+WG +WG 
93B+WP3D+WM  Bz  D{ B~ 
9+WM 3B+WP 
93D+WP 3B+WZ3@|+WW |  B{ |  D| B} 
9+WW 3B+WZ 
93@|+WZ 3B+Wa ~ XI,jm B| },T  | XL,jf B+U ~  B| D| D|  B{3B+Wg +Wg 
92B+Wk 
96XF1V+Wk 3B+Wy  B{  D|3BXL+Wp +Wp 
93B+Wy3D+Wv  B{  D| B} 
9+Wv 3B+Wy 
93D+Wy 3B+W~ },T  XL,jm B+U ~  B| D| D|  B{3B+X +X 
92B+X 
96XF1V+X 3B+X9  B{  D|3BXN+X
 +X
93B+X93D+X  B{  D| B} 
9+X 3B+X96XG0V+X/  B{  D|   B{ D{ D{  Bz3B+X +X 
92B+X! 
96XG1V+X! 3B+X/  Bz  D{3BXM+X& +X& 
93B+X/3D+X,  Bz  D{ B~ 
9+X, 3B+X/ 
93D+X/ 3B+X93@|+X6 |  B{ |  D| B} 
9+X6 3B+X9 
93@|+X9 3B+XB },T B| ~ XM,jm B| },T  | | XN,jn B+U  D ~ B+U >y,~<{<<z<y<|<
1<<
,<<
,<
1<
-<
2<
2<
3<
3<
2XS<
2XT<
2XU<<@XV<@XW<@XX<@XY<@<<@<
,<@<
,<@<
-<@>	 Bx,jG  B D2@+X` +_}     D @| 
    B~ D~ F} H} J| 
| L|   D{ D{  Bz3B+Xm +Xn 
92B+Xq 
96_1V+Xq 3B+Y=   D{3B`
+Xv +Xv 
93B+Y=3D+X|  Bz  D{ B~ 
9+X| 3B+Y=3D+Y  Bz  D{ B} 
9+Y 3B+Y= ,jG Bz3@{+Y 
{6_0V+Y {   Bz Dy Dz  By3B+Y +Y 
92B+Y 
96`1V+Y 3B+Y  By  Dy3B`
+Y +Y 
93B+Y 
9+Y 3B+Y z  B} 
9+Y" {  {  D{  z,jG Bz+Y3B+Y=6`0V+Y9 {  Bz {  D{   Bz Dz Dz  By3B+Y- +Y. 
92B+Y1 
96`1V+Y1 3B+Y:  By  Dz3B`
+Y6 +Y7 
93B+Y: D| 
9+Y: 3B+Y= 
93@{+Y= 3B+YD | },jI },j| ~,j| `
,j| ,j< B+X^ ~  B{ D{ D{  Bz3B+YJ +YJ 
92B+YN 
96_1V+YN 3B+[F  Bz  D{3B`
+YS +YS 
93B+[F ,jG Bz3@{+ZH 
{6_0V+ZF {   Bz Dy Dz  By3B+Y_ +Y_ 
92B+Yc 
96`1V+Yc 3B+ZG  By  Dy3B`	+Yh +Yh 
93B+ZG6`0V+ZC  By  Dy   By Dx Dy  Bx3B+Yr +Ys 
92B+Yv 
96`1V+Yv 3B+ZD  Bx  Dx3B`	+Y{ +Y| 
93B+ZD6`0V+Z  Bx  Dx   Bx Dw Dx  Bw3B+Z +Z 
92B+Z
 
96`1V+Z
 3B+Z  Bw  Dw3B`+Z +Z 
93B+Z 
93D+Z 3B+ZD6`0V+Z) x  Bx x  Dx   Bx Dw Dx  Bw3B+Z +Z 
92B+Z! 
96`1V+Z! 3B+Z)  Bw  Dw3B`
+Z& +Z' 
93B+Z) 
9+Z) 3B+ZD6`0V+Z@ x  Bx x  Dx   Bx Dw Dx  Bw3B+Z4 +Z5 
92B+Z8 
96`1V+Z8 3B+ZA  Bw  Dw3B`+Z= +Z> 
93B+ZA 
93D+ZA 3B+ZD 
93@x+ZD 3B+ZG 
93@y+ZG 3B+ZJ z  B} 
9+ZP {  Bz {  D{  z,jG Bz+YV3B+[F6`0V+[C {  Bz {  D{   Bz Dz Dz  By3B+Z[ +Z[ 
92B+Z_ 
96`1V+Z_ 3B+[C  By  Dz3B`	+Zd +Zd 
93B+[C6`0V+[@  By  Dz   By Dy Dy  Bx3B+Zn +Zo 
92B+Zr 
96`1V+Zr 3B+[@  Bx  Dy3B`	+Zw +Zx 
93B+[@6`0V+[  Bx  Dy   Bx Dx Dx  Bw3B+[ +[ 
92B+[ 
96`1V+[ 3B+[  Bw  Dx3B`+[ +[ 
93B+[ 
93D+[ 3B+[@6`0V+[% y  Bx y  Dy   Bx Dx Dx  Bw3B+[ +[ 
92B+[ 
96`1V+[ 3B+[&  Bw  Dx3B`
+[" +[# 
93B+[& D| 
9+[& 3B+[@6`0V+[= y  Bx y  Dy   Bx Dx Dx  Bw3B+[1 +[1 
92B+[5 
96`1V+[5 3B+[=  Bw  Dx3B`+[: +[: 
93B+[= 
93D+[= 3B+[@ 
93@y+[@ 3B+[C 
93@z+[C 3B+[F 
{ L| 
93B+[S | `
,j<,t `,j< `,j| `	,j|  `	,jm |,j<  },jI `
,j| ,j< B+X^ ~  B{ D{ D{  Bz3B+[X +[Y 
92B+[\ 
96_1V+[\ 3B+]  Bz  D{3B`
+[a +[b 
93B+] ,jG Bz3@{+\- 
{6_0V+\+ {   Bz Dy Dz  By3B+[m +[n 
92B+[q 
96`1V+[q 3B+\,  By  Dy3B`	+[v +[w 
93B+\,6`0V+\#  By  Dy   By Dx Dy  Bx3B+\ +\ 
92B+\ 
96`1V+\ 3B+\$  Bx  Dx3B`+\
 +\
 
93B+\$6`0V+\   Bx  Dx   Bx Dw Dx  Bw3B+\ +\ 
92B+\ 
96`1V+\ 3B+\!  Bw  Dw3B`+\ +\ 
93B+\! 
93D+\! 3B+\$ 
93@x+\$ 3B+\,3@y+\( y  By 
9+\) 3B+\, 
93@y+\, 3B+\/ z  B} 
9+\5 {  Bz {  D{  z,jG Bz+[d3B+]6`0V+] {  Bz {  D{   Bz Dz Dz  By3B+\@ +\@ 
92B+\D 
96`1V+\D 3B+]  By  Dz3B`	+\I +\I 
93B+]6`0V+\v  By  Dz   By Dy Dy  Bx3B+\S +\T 
92B+\W 
96`1V+\W 3B+\v  Bx  Dy3B`+\\ +\] 
93B+\v6`0V+\s  Bx  Dy   Bx Dx Dx  Bw3B+\g +\g 
92B+\k 
96`1V+\k 3B+\s  Bw  Dx3B`+\p +\p 
93B+\s 
93D+\s 3B+\v 
93@y+\v 3B+]3@z+\} z  By z  Dz B} 
9+\} 3B+] 
93@z+] 3B+] 
{ L| 
93B+],jm |,j< `,j| `,j|  },jI `
,j| ,j< B+X^ ~  B{ D{ D{  Bz3B+] +] 
92B+] 
96_1V+] 3B+^:  Bz  D{3B`
+] +] 
93B+^: ,jG Bz3@{+]e 
{6_0V+]d {   Bz Dy Dz  By3B+]' +]( 
92B+]+ 
96`1V+]+ 3B+]d  By  Dy3B`	+]0 +]1 
93B+]d6`0V+]\  By  Dy   By Dx Dy  Bx3B+]; +]; 
92B+]? 
96`1V+]? 3B+]\  Bx  Dx3B`+]D +]D 
93B+]\6`0V+]Y  Bx  Dx   Bx Dw Dx  Bw3B+]N +]O 
92B+]R 
96`1V+]R 3B+]Y  Bw  Dw 
93@w+]Y 3B+]\ 
93@x+]\ 3B+]d3@y+]a y  By 
9+]a 3B+]d 
93@y+]d 3B+]h z  B} 
9+]m {  Bz {  D{  z,jG Bz+]3B+^:6`0V+^7 {  Bz {  D{   Bz Dz Dz  By3B+]x +]y 
92B+]| 
96`1V+]| 3B+^7  By  Dz3B`	+^ +^ 
93B+^76`0V+^-  By  Dz   By Dy Dy  Bx3B+^
 +^
 
92B+^ 
96`1V+^ 3B+^-  Bx  Dy3B`+^ +^ 
93B+^-6`0V+^*  Bx  Dy   Bx Dx Dx  Bw3B+^ +^  
92B+^# 
96`1V+^# 3B+^*  Bw  Dx 
93@x+^* 3B+^- 
93@y+^- 3B+^73@z+^4 z  By z  Dz B} 
9+^4 3B+^7 
93@z+^7 3B+^: 
{ L| 
93B+^D } `	,jm |,j< `,j| `,j|  },jI `
,j| ,j< B+X^ ~  B{ D{ D{  Bz3B+^I +^J 
92B+^M 
96_1V+^M 3B+_q  Bz  D{3B`
+^R +^S 
93B+_q ,jG Bz3@{+_ 
{6_0V+_ {   Bz Dy Dz  By3B+^^ +^_ 
92B+^b 
96`1V+^b 3B+_  By  Dy3B`	+^g +^h 
93B+_6`0V+_  By  Dy   By Dx Dy  Bx3B+^r +^r 
92B+^v 
96`1V+^v 3B+_  Bx  Dx3B`+^{ +^{ 
93B+_6`0V+_  Bx  Dx   Bx Dw Dx  Bw3B+_ +_ 
92B+_	 
96`1V+	 3B+  Bw  Dw 
93@w+_ 3B+_ 
93@x+_ 3B+_3@y+_ y  By 
9+_ 3B+_ 
93@y+_ 3B+_ z  B} 
9+_$ {  Bz {  D{  z,jG Bz+^U3B+_q6`0V+_n {  Bz {  D{   Bz Dz Dz  By3B+_/ +_0 
92B+_3 
96`1V+_3 3B+_n  By  Dz3B`	+_8 +_9 
93B+_n6`0V+_d  By  Dz   By Dy Dy  Bx3B+_C +_C 
92B+_G 
96`1V+_G 3B+_d  Bx  Dy3B`+_L +_L 
93B+_d6`0V+_a  Bx  Dy   Bx Dx Dx  Bw3B+_V +_W 
92B+_Z 
96`1V+Z 3B+a  Bw  Dx 
93@x+_a 3B+_d 
93@y+_d 3B+_n3@z+_k z  By z  Dz B} 
9+_k 3B+_n 
93@z+_n 3B+_q 
{ L| 
93B+_{ } `	,jm |,j< `,j| `,j|  },jI `
,j| ,j< B+X^  D ~ B+X^ >v,~<z<0<y<{<y<<x<w<x<wXNXO<
3XP<
1<
1XQXR<<<
4<
2<
4> Bx,jG  B D2@+` +bJ     D @| @| @| 
    B~ D~ F} H} J| 
| L| 
| L{ 
| L{   Dz Dz  By3B+`  +`! 
92B+`$ 
96bK1V+`$ 3B+`2   Dz3BbN+`) +`) 
93B+`23D+`/  By  Dz B} 
9+`/ 3B+`2 
93D+`2 3B+`5 
} L+` ~  Bz Dz Dz  By3B+`: +`; 
92B+`> 
96bK1V+`> 3B+`R  By  Dz3BbN+`C +`D 
93B+`R3D+`I  By  Dz B~ 
9+`J 3B+`R3D+`O  By  Dz B} 
9+`P 3B+`R D{ 
93B+`X { bN,j< },j| ~,j| ,j< B+` ~  Bz Dz Dz  By3B+`^ +`^ 
92B+`b 
96bK1V+`b 3B+`|3D+`g  By  Dz B~ 
9+`h 3B+`|3D+`m  By  Dz B} 
9+`n 3B+`|  By  Dz3BbN+`s +`s 
93B+`|3D+`y  By  Dz B} 
9+`y 3B+`| 
93D+`| 3B+a } } ~ bM,jn B+` ~  Bz Dz Dz  By3B+a +a 
92B+a
 
96bK1V+a
 3B+a<3D+a  By  Dz B~ 
9+a 3B+a<3D+a  By  Dz B} 
9+a 3B+a<3D+a ,jG By z  By z  Dz  y,jG+a  By3@z+a# 
z 
02LbN+a&3@y+a% y +a, +a, z  By z  Dz  y,jG By+a  B|3B+a< z  By z  Dz3BbN+a2 +a3 
93B+a<3D+a8  By  Dz B} 
9+a9 3B+a< 
93D+a< 3B+aD } } ~ bM,jn  bN,jm  |,jI ,j< B+` ~  Bz Dz Dz  By3B+aJ +aJ 
92B+aN 
96bK1V+aN 3B+b+3D+aS  By  Dz B~ 
9+aT 3B+b+6bL0V+ap  By  Dz   By Dy Dy  Bx3B+a^ +a^ 
92B+ab 
96bL1V+ab 3B+ap  Bx  Dy3BbM+ag +ag 
93B+ap3D+am  Bx  Dy B} 
9+am 3B+ap 
93D+ap 3B+b+ ,jG By3@z+av 
z 
02LbN+ax y  B| 
9+a~ z  By z  Dz  y,jG By+as3B+b+ z  By z  Dz3BbN+b +b 
93B+b+3D+b
  By  Dz B} 
9+b
 3B+b+6bL0V+b&  By  Dz   By Dy Dy  Bx3B+b +b 
92B+b 
96bL1V+b 3B+b'  Bx  Dy3BbM+b +b 
93B+b'3D+b#  Bx  Dy B| 
9+b$ 3B+b' 
93D+b' 3B+b+3@z+b* z B{+b+ 3B+` |  } ,t B{2B+b< } bM,jm }  ~ bM,jn Bz | bM,jm {,j< z,j| bN,j|  |,jI ,j< B3@{+` | bM,jm Bz } bM,jm Bz { bN,j<  |,jI z,j| ~,j| z,j| },j| ,j< B+` >x,~<y<<x<
2<
3<
0<<@<	<@<<@<<@bTbU<
.<@<
5bVbW</bXbY<
,bZb[<
,b\b]<b^b_<b`ba<bbbc<bdbe<
5bfbg<bhbi<:bjbk<
6blbm<bnbo<:bpbq<brbs<
6btbu<
7bvbw<
7bxby<
8bzb{<
8b|b}<
9b~b<
-cc<
9cc<
:cc<
:cc<
;c<@<
;D20FOR$NEXT-TOKENKD20FOR$EXPRTYPEARKNSTANT-TOKEN%w
D20FOR$NEXT-LOGICAL-TOKENTANTD20FOR$NEXT-LOGICAL-CONSTANT-TOKEN
D20FOR$NEXT-GENERAL-TOKENENTGENERALEXRELATIONAL-LOGLOGICAL-CONSTANTTSLOGICALE-	ARITHMETIC-CONSTANTARITHMETICTYPED20FOR$NEXT-ARITHMETIC-TOKEN-PRINTD20FOR$CHARACTER-CONSTANT-EXPRESSION%wD20FOR$NEXT-ARITHMETIC-CONSTANT-TOKEN-PRINTD20FOR$NEXT-CHARACTER-TOKEN-PRINTD20FOR$NEXT-CHARACTER-CONSTANT-TOKEN-PRINTD20FOR$NEXT-LOGICAL-TOKEN-PRINTD20FOR$NEXT-LOGICAL-CONSTANT-TOKEN-PRINT
D20FOR$DOT-OPERATOR-PRINTD20FOR$PRINTEXPRORD20FOR$PRINTEXPR1RCONTAINSBADUNARYRPLUSORMINUSPER 
d2LL+cs+t. 
d2LL+cu+t. 
d2LL+cw+t/ 
d2LL+cy+t/ 
d2LL+c{+t0 
d2LL+c}+t0 
d2LL+c+t1 
d2LL+d+t1 ,~<
A<
A<
B<
B<
<.<
C<
C)TTE(TTE/TTE*TTE+TTE-TTE^INT**TE.FALSE.OM.TRUE.OM<>ddd<	Bddd<>dd<@d<@<=ddd,PEA<	B<@> 
 Bx f	,kj B2@	+e f,kj B2@	+d+ ,jG 
 B~ D~   f,pw ~  B~ ,kk ~3Bf+d.  f	,kh+d/ 
x L
 f,kj B2@	+d9 ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+d<  f	,kh+d= 
x L
 f,kj B2@	+dG ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+dK  f	,kh+dL 
x L
 f,kj B2@	+dX ,jG 
 B~ D~   f,pw ~ ~ f,pv ~  B~ ,kk ~ B3Bf+d[  f	,kh+d\ 
x L
 f,kj B2@	+df ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+dj  f	,kh+dk 
x L
 f,kj B2@	+du ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+dx  f	,kh+dy 
x L
 f,kj B2@	+e ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+e  f	,kh+e 
x L
 f,kj B2@	+e ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+e  f	,kh+e 
x L
 f,kj B2@	+e  ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+e$  f	,kh+e% 
x L
 f,kj B2@	+e/ ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+e2  f	,kh+e3 
x L
 f,kj B2@	+e= ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+eA  f	,kh+eB 
x L
 f,kj B2@	+eL ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+eO  f	,kh+eP 
x L
 f,kj B2@	+eZ ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+e^  f	,kh+e_ 
x L
 f,kj B2@	+ei ,jG 
 B~ D~   f,pw ~  B~ ,kk ~ B3Bf+el  f	,kh+em 
x L
 f,kj B2@	+ew ,jG 
 B~ D~   f,pw ~  B~ ,kk ~3Bf+ez  f	,kh+e{ 
x L
 
x L
 f B ,kk >},~dddd	d
dd
dd<
d<	C<
<
<~<
<<})TTE(TTE/TTE*TTE+TTE-TTE^INT**TE.FALSE.OM.TRUE.OM<>ff
f<	Bfff<>ff	<@f<@<=fff,PEA<	B<@> Bx  B hK,kj B2@	+hA hK,kj B~2@	+f46hB1V+f*  hK,kh  B~ x B}  B}  ~ hJ,p|3B+f2 }  D}  
9 B~ ~,kk ~3B+f7 
9 hK,kh hK,kj B~2@	+fG6hB1V+f<  hK,kh  B~ x B}  B}  ~ hJ,p|3B+fE }  D}  F} 
9 B~ ~,kk ~3B+fJ 
9 hK,kh hK,kj B~2@	+fZ6hB1V+fO  hK,kh  B~ x B}  B}  ~ hI,p|3B+fX }  D}  F} 
9 B~ ~,kk ~3B+f] 
9 hK,kh hK,kj B~2@	+fq6hB1V+fb  hK,kh  B~ x B}  B}  ~ hI,p|3B+fk }  D}  F} } } ~ hH,p{ B}  
9 B~ ~,kk ~3B+fs 
9 hK,kh hK,kj B~2@	+g6hB1V+fy  hK,kh  B~ x B}   ~ hH,p|3B+g }  D}  
9 B~ ~,kk ~3B+g 
9 hK,kh hK,kj B~2@	+g6hB1V+g  hK,kh  B~ x B}  hG  ~ hG,p}3B+g }  D}  
9 B~ ~,kk ~3B+g 
9 hK,kh hK,kj B~2@	+g(6hB1V+g  hK,kh  B~ x B}  hG  ~ hG,p}3B+g% }  D}  
9 B~ ~,kk ~3B+g* 
9 hK,kh hK,kj B~2@	+g:6hB1V+g0  hK,kh  B~ x B}  hF  ~ hF,p}3B+g8 }  D}  
9 B~ ~,kk ~3B+g= 
9 hK,kh hK,kj B~2@	+gM6hB1V+gB  hK,kh  B~ x B}  hF  ~ hF,p}3B+gJ }  D}  
9 B~ ~,kk ~3B+gO 
9 hK,kh hK,kj B~2@	+g_6hB1V+gU  hK,kh  B~ x B}  hE  ~ hE,p}3B+g] }  D}  
9 B~ ~,kk ~3B+gb 
9 hK,kh hK,kj B~2@	+gr6hB1V+gg  hK,kh  B~ x B}  hE  ~ hE,p}3B+go }  D}  
9 B~ ~,kk ~3B+gt 
9 hK,kh hK,kj B~2@	+h6hB1V+gz  hK,kh  B~ x B}  hD  ~ hD,p}3B+h }  D}  
9 B~ ~,kk ~3B+h 
9 hK,kh hK,kj B~2@	+h6hB1V+h
  hK,kh  B~ x B}  hD  ~ hD,p}3B+h }  D}  
9 B~ ~,kk ~3B+h 
9 hK,kh hK,kj B~2@	+h)6hB1V+h  hK,kh  B~ x B}  hC  ~ hC,p}3B+h' }  D}  
9 B~ ~,kk ~3B+h, 
9 hK,kh hK,kj B~2@	+h;6hB1V+h1  hK,kh  B~ x B}  hC  ~ hC,p}3B+h9 }   
9 B~ ~,kk ~3B+h> 
9 hK,kh 
 L  B~ ,kk ~>|,~<xf	f
ff
fffff<
f<	C<
<
<
<<}/TTE*TTE+TTE-TTE^INT**TE)0FO(HARICHARND> 
 Bx j(,kj B2@	+j j',kj B2@	+hd ,jG 
 B~ D~   j',pw ~  B~ ,kk ~3Bj&+hg  j(,kh+hh 
x L
 j',kj B2@	+hr ,jG 
 B~ D~   j&,pw ~  B~ ,kk ~ B3Bj&+hu  j(,kh+hv 
x L
 j',kj B2@	+i ,jG 
 B~ D~   j%,pw ~  B~ ,kk ~ B3Bj&+i  j(,kh+i 
x L
 j',kj B2@	+i ,jG 
 B~ D~   j%,pw ~ ~ j$,pw ~ ~ j$,pw ~ ~ j#,pw ~  B~ ,kk ~ B3Bj&+i  j(,kh+i 
x L
 j',kj B2@	+i# ,jG 
 B~ D~   j#,pw ~  B~ ,kk ~ B3Bj&+i'  j(,kh+i( 
x L
 j',kj B2@	+i2 ,jG 
 B~ D~   j",pw ~  B~ ,kk ~ B3Bj&+i5  j(,kh+i6 
x L
 j',kj B2@	+i@ ,jG 
 B~ D~   j",pw ~  B~ ,kk ~ B3Bj&+iD  j(,kh+iE 
x L
 j',kj B2@	+iO ,jG 
 B~ D~   j!,pw ~  B~ ,kk ~ B3Bj&+iR  j(,kh+iS 
x L
 j',kj B2@	+i] ,jG 
 B~ D~   j!,pw ~  B~ ,kk ~ B3Bj&+ia  j(,kh+ib 
x L
 j',kj B2@	+il ,jG 
 B~ D~   j ,pw ~  B~ ,kk ~ B3Bj&+io  j(,kh+ip 
x L
 j',kj B2@	+iz ,jG 
 B~ D~   j ,pw ~  B~ ,kk ~ B3Bj&+i~  j(,kh+i 
x L
 j',kj B2@	+j	 ,jG 
 B~ D~   j$,pw ~  B~ ,kk ~ B3Bj&+j
  j(,kh+j
x L
 j',kj B2@	+j ,jG 
 B~ D~   j#,pw ~  B~ ,kk ~3Bj&+j  j(,kh+j 
x L
 
x L
 j& B ,kk >},~hLhMhNhOhPhQ<
hR<
DhShT<	C<
<~<
<<}/TTE*TTE+TTE-TTE^INT**TE)0FO(HARICHARND> Bx  B lF,kj B2@	+l= lE,kj B~2@	+jG6l>1V+j<  lE,kh  B~ x B}  B}  ~ lE,p|3B+jD }  D}  
9 B~ ~,kk ~3B+jI 
9 lF,kh lE,kj B~2@	+jZ6l>1V+jO  lE,kh  B~ x B}  B}  ~ lD,p|3B+jW }  D}  F} 
9 B~ ~,kk ~3B+j\ 
9 lF,kh lE,kj B~2@	+jm6l>1V+jb  lE,kh  B~ x B}  B}  ~ lD,p|3B+jj }  D}  F} 
9 B~ ~,kk ~3B+jo 
9 lF,kh lE,kj B~2@	+k6l>1V+ju  lE,kh  B~ x B}  B} lC  ~ lC,p}3B+j~ }  D}  F} lC } ~ lC,p}3B+k }  D}  F} } ~ lB,p|3B+k	 }  D}  F} lB } ~ lB,p}3B+k }  D}  
9 B~ ~,kk ~3B+k 
9 lF,kh lE,kj B~2@	+k#6l>1V+k  lE,kh  B~ x B}   ~ lA,p|3B+k! }  D}  
9 B~ ~,kk ~3B+k& 
9 lF,kh lE,kj B~2@	+k66l>1V+k+  lE,kh  B~ x B}  lA  ~ lA,p}3B+k3 }  D}  
9 B~ ~,kk ~3B+k8 
9 lF,kh lE,kj B~2@	+kH6l>1V+k>  lE,kh  B~ x B}  lA  ~ l@,p}3B+kF }  D}  
9 B~ ~,kk ~3B+kK 
9 lF,kh lE,kj B~2@	+k[6l>1V+kP  lE,kh  B~ x B}  l@  ~ l@,p}3B+kX }  D}  
9 B~ ~,kk ~3B+k] 
9 lF,kh lE,kj B~2@	+km6l>1V+kc  lE,kh  B~ x B}  l?  ~ l?,p}3B+kk }  D}  
9 B~ ~,kk ~3B+kp 
9 lF,kh lE,kj B~2@	+l6l>1V+ku  lE,kh  B~ x B}  l?  ~ l?,p}3B+k} }  D}  
9 B~ ~,kk ~3B+l 
9 lF,kh lE,kj B~2@	+l6l>1V+l  lE,kh  B~ x B}  l>  ~ l>,p}3B+l }  D}  
9 B~ ~,kk ~3B+l 
9 lF,kh lE,kj B~2@	+l%6l>1V+l  lE,kh  B~ x B}  lC  ~ lC,p}3B+l" }  D}  
9 B~ ~,kk ~3B+l' 
9 lF,kh lE,kj B~2@	+l76l>1V+l-  lE,kh  B~ x B}  lB  ~ lB,p}3B+l4 }   
9 B~ ~,kk ~3B+l9 
9 lF,kh 
 L  B~ ,kk ~>|,~<xj(j)j*j+j,j-<
j.<
Dj/j0<	C<
<
<<})TTE(TTE//TE<>lK<>lLlGlMlGlNlOlP<	BlQ<>lRlSlTlUlV<	C<@:0FOlOlV<>lWlF<@lX<@<=lYlZl[,PEA<	B<@> 
 Bx m5,kj B2@	+m0 m5,kj B2@	+lk ,jG 
 B~ D~   m4,pw ~  B~ ,kk ~3Bm4+ln  m5,kh+lo 
x L
 m5,kj B2@	+l} ,jG 
 B~ D~   m3,pw ~ ~ m3,pv ~ ~ m2,pv ~  B~ ,kk ~ B3Bm4+m  m5,kh+m 
x L
 m5,kj B2@	+m ,jG 
 B~ D~   m2,pw ~  B~ ,kk ~ B3Bm4+m  m5,kh+m 
x L
 m5,kj B2@	+m ,jG 
 B~ D~   m1,pw ~  B~ ,kk ~ B3Bm4+m  m5,kh+m 
x L
 m5,kj B2@	+m( ,jG 
 B~ D~   m1,pw ~  B~ ,kk ~3Bm4+m+  m5,kh+m, 
x L
 
x L
 m4 B ,kk >},~lFlGlHlIlJ<	C<~<
<<})TTE(TTE//TE<>m;<>m<m7m=m7m>m?m@<	BmA<>mBmCmDmEmF<	C<@:0FOm?mF<>mGm6<@mH<@<=mImJmK,PEA<	B<@> Bx  B n=,kj B2@	+n8 n=,kj B~2@	+ma6n91V+mV  n=,kh  B~ x B}  B}  ~ n<,p|3B+m^ }  D}  
9 B~ ~,kk ~3B+mc 
9 n=,kh n=,kj B~2@	+m{6n91V+mi  n=,kh  B~ x B}  B}  ~ n<,p|3B+mq }  D}  F} } } ~ n;,p{ B}    ~ n;,p{ B}  
9 B~ ~,kk ~3B+m} 
9n=,khn=,kjB~2@	+n B~2@	+p6p:1V+p  p>,kh  B~ x B}  p;  ~ p;,p}3B+p
 }  D}  
9 B~ ~,kk ~3B+p 
9 p?,kh p>,kj B~2@	+p!6p:1V+p  p>,kh  B~ x B}  p<  ~ p<,p}3B+p }  D}  
9 B~ ~,kk ~3B+p$ 
9 p?,kh p>,kj B~2@	+p36p:1V+p)  p>,kh  B~ x B}  p;  ~ p;,p}3B+p1 }   
9 B~ ~,kk ~3B+p6 
9 p?,kh 
 L  B~ ,kk ~>|,~<xo,o-<	Co.o/<	C<
<<})TTE(TTE.XOR.NOM.NEQV.OM.EQV.NOM.OR..AND.NOM.NOT.NOM<>pN.FALSE.EC.TRUE.ECp@pO<	BpPpQpR<>pSp?<@pT<@<=pUpVpW,PEA<	B<@> 
 Bx r5,kj B2@	+r, r5,kj B2@	+pf ,jG 
 B~ D~   r4,pw ~  B~ ,kk ~3Br4+pi  r5,kh+pj 
x L
 r5,kj B2@	+pt ,jG 
 B~ D~   r3,pw ~  B~ ,kk ~ B3Br4+px  r5,kh+py 
x L
 r5,kj B2@	+q ,jG 
 B~ D~   r3,pw ~  B~ ,kk ~ B3Br4+q  r5,kh+q 
x L
 r5,kj B2@	+q ,jG 
 B~ D~   r2,pw ~  B~ ,kk ~ B3Br4+q  r5,kh+q 
x L
 r5,kj B2@	+q" ,jG 
 B~ D~   r2,pw ~ ~ r1,pv ~  B~ ,kk ~ B3Br4+q%  r5,kh+q& 
x L
 r5,kj B2@	+q0 ,jG 
 B~ D~   r1,pw ~  B~ ,kk ~ B3Br4+q4  r5,kh+q5 
x L
 r5,kj B2@	+q? ,jG 
 B~ D~   r0,pw ~  B~ ,kk ~ B3Br4+qB  r5,kh+qC 
x L
 r5,kj B2@	+qM ,jG 
 B~ D~   r0,pw ~  B~ ,kk ~ B3Br4+qQ  r5,kh+qR 
x L
 r5,kj B2@	+q\ ,jG 
 B~ D~   r/,pw ~  B~ ,kk ~ B3Br4+q_  r5,kh+q` 
x L
 r5,kj B2@	+qj ,jG 
 B~ D~   r/,pw ~  B~ ,kk ~ B3Br4+qn  r5,kh+qo 
x L
 r5,kj B2@	+qy ,jG 
 B~ D~   r.,pw ~  B~ ,kk ~ B3Br4+q|  r5,kh+q} 
x L
 r5,kj B2@	+r ,jG 
 B~ D~   r.,pw ~  B~ ,kk ~ B3Br4+r  r5,kh+r
 
x L
 r5,kj B2@	+r ,jG 
 B~ D~   r-,pw ~  B~ ,kk ~ B3Br4+r  r5,kh+r 
x L
 r5,kj B2@	+r$ ,jG 
 B~ D~   r-,pw ~  B~ ,kk ~3Br4+r'  r5,kh+r( 
x L
 
x L
 r4 B ,kk >},~p?p@pApCpDpFpGpH<
pJ<	CpKpL<
<~<
<<})TTE(TTE.XOR.NOM.NEQV.OM.EQV.NOM.OR..AND.NOM.NOT.NOM<>rD.FALSE.EC.TRUE.ECr7rE<	BrFrGrH<>rIr6<@rJ<@<=rKrLrM,PEA<	B<@> Bx  B ti,kj B2@	+t_ th,kj B~2@	+rc6t`1V+rY  th,kh  B~ x B}  B}  ~ th,p|3B+ra }  D}  
9 B~ ~,kk ~3B+rf 
9 ti,kh th,kj B~2@	+rv6t`1V+rk  th,kh  B~ x B}  B}  ~ tg,p|3B+rt }  D}  F} 
9 B~ ~,kk ~3B+ry 
9 ti,kh th,kj B~2@	+s
6t`1V+r~  th,kh  B~ x B}  B} tg  ~ tg,p}3B+s }  D}  F} 
9 B~ ~,kk ~3B+s
 
9 ti,kh th,kj B~2@	+s6t`1V+s  th,kh  B~ x B}  B} tf  ~ tf,p}3B+s }  D}  F} 
9 B~ ~,kk ~3B+s  
9 ti,kh th,kj B~2@	+s46t`1V+s%  th,kh  B~ x B}  B}  ~ tf,p|3B+s. }  D}  F} } } ~ te,p{ B}  
9 B~ ~,kk ~3B+s6 
9 ti,kh th,kj B~2@	+sF6t`1V+s<  th,kh  B~ x B}   ~ te,p|3B+sC }  D}  
9 B~ ~,kk ~3B+sH 
9 ti,kh th,kj B~2@	+sX6t`1V+sN  th,kh  B~ x B}  td  ~ td,p}3B+sV }  D}  
9 B~ ~,kk ~3B+s[ 
9 ti,kh th,kj B~2@	+sk6t`1V+s`  th,kh  B~ x B}  td  ~ td,p}3B+sh }  D}  
9 B~ ~,kk ~3B+sm 
9 ti,kh th,kj B~2@	+s}6t`1V+ss  th,kh  B~ x B}  tc  ~ tc,p}3B+s{ }  D}  
9 B~ ~,kk ~3B+t 
9ti,khDth,kjB~2@	+t6t`1V+t  th,kh  B~ x B}  tc  ~ tc,p}3B+t
9 B~ ~,kk ~3B+t 
9 ti,kh th,kj B~2@	+t"6t`1V+t  th,kh  B~ x B}  tb  ~ tb,p}3B+t  }  D}  
9 B~ ~,kk ~3B+t% 
9 ti,kh th,kj B~2@	+t56t`1V+t*  th,kh  B~ x B}  tb  ~ tb,p}3B+t2 }  D}  
9 B~ ~,kk ~3B+t7 
9 ti,kh th,kj B~2@	+tG6t`1V+t=  th,kh  B~ x B}  ta  ~ ta,p}3B+tE }  D}  
9 B~ ~,kk ~3B+tJ 
9 ti,kh th,kj B~2@	+tY6t`1V+tO  th,kh  B~ x B}  ta  ~ ta,p}3B+tW }   
9 B~ ~,kk ~3B+t\ 
9 ti,kh 
 L  B~ ,kk ~>|,~<xr6r7r8r9r;r<r=r?<
r@<	CrArC<
<
<<})TTE(TTE.XOR.ND.NEQV.D.EQV.ND.OR..AND.ND.NOT.ND.FALSE.EX.TRUE.EX> 
 Bx v%,kj B2@	+v v$,kj B2@	+u ,jG 
 B~ D~   v$,pw ~  B~ ,kk ~3Bv#+u  v%,kh+u	 
x L
 v$,kj B2@	+u ,jG 
 B~ D~   v#,pw ~  B~ ,kk ~ B3Bv#+u  v%,kh+u 
x L
 v$,kj B2@	+u" ,jG 
 B~ D~   v",pw ~  B~ ,kk ~ B3Bv#+u%  v%,kh+u& 
x L
 v$,kj B2@	+u0 ,jG 
 B~ D~   v",pw ~  B~ ,kk ~ B3Bv#+u4  v%,kh+u5 
x L
 v$,kj B2@	+u? ,jG 
 B~ D~   v!,pw ~  B~ ,kk ~ B3Bv#+uB  v%,kh+uC 
x L
 v$,kj B2@	+uM ,jG 
 B~ D~   v!,pw ~  B~ ,kk ~ B3Bv#+uQ  v%,kh+uR 
x L
 v$,kj B2@	+u\ ,jG 
 B~ D~   v ,pw ~  B~ ,kk ~ B3Bv#+u_  v%,kh+u` 
x L
 v$,kj B2@	+uj ,jG 
 B~ D~   v ,pw ~  B~ ,kk ~ B3Bv#+un  v%,kh+uo 
x L
 v$,kj B2@	+uy ,jG 
 B~ D~   v,pw ~  B~ ,kk ~ B3Bv#+u|  v%,kh+u} 
x L
 v$,kj B2@	+v ,jG 
 B~ D~   v,pw ~  B~ ,kk ~ B3Bv#+v  v%,kh+v
 
x L
 v$,kj B2@	+v ,jG 
 B~ D~   v,pw ~  B~ ,kk ~3Bv#+v  v%,kh+v 
x L
 
x L
,v# B2,kk>},~titjtktmtntptqtr<	Ctt<~tu<<})TTE(TTE.XOR.ND.NEQV.D.EQV.ND.OR..AND.ND.NOT.ND.FALSE.EX.TRUE.EX> Bx  B x
  ~ x
,p}3B+vE }  D}  
9 B~ ~,kk ~3B+vJ 
9x x~2@	+vZ6x1V+vP  x
  ~ x
,p}3B+vX }  D}  
9 B~ ~,kk ~3B+v] 
9x x~2@	+vl6x1V+vb  x,p|3B+vj }  D}  
9 B~ ~,kk ~3B+vo 
9x x~2@	+v6x1V+vt  x~ x,p}3B+v| }  D}  
9 B~ ~,kk ~3B+w 
9x x~2@	+w6x1V+w  x
  ~ x
,p}3B+w }  D}  
9 B~ ~,kk ~3B+w 
9x x~2@	+w$6x1V+w  x
  ~ x
,p}3B+w! }  D}  
9 B~ ~,kk ~3B+w& 
9x x~2@	+w66x1V+w,  x~ x	,p}3B+w4 }  D}  
9 B~ ~,kk ~3B+w9 
9x x~2@	+wI6x1V+w>  x~ x	,p}3B+wF }  D}  
9 B~ ~,kk ~3B+wK 
9x x~2@	+w[6x1V+wQ  x~ x,p}3B+wY }  D}  
9 B~ ~,kk ~3B+w^ 
9x x~2@	+wn6x1V+wc  x~ x,p}3B+wk }  D}  
9 B~ ~,kk ~3B+wp 
9x x~2@	+x6x1V+wv  x~ x,p}3B+w} }   
9 B~ ~,kk ~3B+x 
9x 
 L  B~ ,kk ~>},~<xv%v&v'v)v*v,v-v.<	Cv0v1<<}#INT.NE.==NT.EQ.<INT.LT.<=NT.LE.>INT.GT.>=NT.GE.> 
 Bx yu,kj B2@	+yl yt,kj B2@	+x( ,jG 
 B~ D~   yt,pw ~  B~ ,kk ~3Bys+x+  yu,kh+x, 
x L
 yt,kj B2@	+x6 ,jG 
 B~ D~   ys,pw ~  B~ ,kk ~ B3Bys+x:  yu,kh+x; 
x L
 yt,kj B2@	+xE ,jG 
 B~ D~   yr,pw ~  B~ ,kk ~ B3Bys+xH  yu,kh+xI 
x L
 yt,kj B2@	+xS ,jG 
 B~ D~   yr,pw ~  B~ ,kk ~ B3Bys+xW  yu,kh+xX 
x L
 yt,kj B2@	+xb ,jG 
 B~ D~   yq,pw ~  B~ ,kk ~ B3Bys+xe  yu,kh+xf 
x L
 yt,kj B2@	+xp ,jG 
 B~ D~   yq,pw ~  B~ ,kk ~ B3Bys+xt  yu,kh+xu 
x L
 yt,kj B2@	+x ,jG 
 B~ D~   yp,pw ~  B~ ,kk ~ B3Bys+y  yu,kh+y 
x L
 yt,kj B2@	+y
 B~ D~   yp,pw ~  B~ ,kk ~ B3Bys+y  yu,kh+y 
x L
 yt,kj B2@	+y ,jG 
 B~ D~   yo,pw ~  B~ ,kk ~ B3Bys+y  yu,kh+y  
x L
 yt,kj B2@	+y* ,jG 
 B~ D~   yo,pw ~  B~ ,kk ~ B3Bys+y.  yu,kh+y/ 
x L
 yt,kj B2@	+y9 ,jG 
 B~ D~   yn,pw ~  B~ ,kk ~ B3Bys+y<  yu,kh+y= 
x L
 yt,kj B2@	+yG ,jG 
 B~ D~   yn,pw ~  B~ ,kk ~ B3Bys+yK  yu,kh+yL 
x L
 yt,kj B2@	+yV ,jG 
 B~ D~   ym,pw ~  B~ ,kk ~ B3Bys+yY  yu,kh+yZ 
x L
 yt,kj B2@	+yd ,jG 
 B~ D~   ym,pw ~  B~ ,kk ~3Bys+yg  yu,kh+yh 
x L
 
x L
 ys B ,kk >},~xxxxxxxxxxxx<
G<~<	C<<}#INT.NE.==NT.EQ.<INT.LT.<=NT.LE.>INT.GT.>=NT.GE.> Bx  B |,kj B2@	+| |,kj B~2@	+z6|
1V+z
  |,kh  B~ x B}   ~ |,p|3B+z }  D}  
9 B~ ~,kk ~3B+z 
9 |,kh |,kj B~2@	+z(6|
1V+z  |,kh  B~ x B}   ~ |,p|3B+z% }  D}  
9 B~ ~,kk ~3B+z* 
9 |,kh |,kj B~2@	+z:6|
1V+z0  |,kh  B~ x B}  |  ~ |,p}3B+z8 }  D}  
9 B~ ~,kk ~3B+z= 
9 |,kh |,kj B~2@	+zM6|
1V+zB  |,kh  B~ x B}  |  ~ |,p}3B+zJ }  D}  
9 B~ ~,kk ~3B+zO 
9 |,kh |,kj B~2@	+z_6|
1V+zU  |,kh  B~ x B}  |  ~ |,p}3B+z] }  D}  
9 B~ ~,kk ~3B+zb 
9 |,kh |,kj B~2@	+zr6|
1V+zg  |,kh  B~ x B}  |  ~ |,p}3B+zo }  D}  
9 B~ ~,kk ~3B+zt 
9 |,kh |,kj B~2@	+{6|
1V+zz  |,kh  B~ x B}  |  ~ |,p}3B+{ }  D}  
9 B~ ~,kk ~3B+{ 
9 |,kh |,kj B~2@	+{6|
1V+{
  |,kh  B~ x B}  |  ~ |,p}3B+{ }  D}  
9 B~ ~,kk ~3B+{ 
9 |,kh |,kj B~2@	+{)6|
1V+{  |,kh  B~ x B}  |  ~ |,p}3B+{' }  D}  
9 B~ ~,kk ~3B+{, 
9 |,kh |,kj B~2@	+{<6|
1V+{1  |,kh  B~ x B}  |  ~ |,p}3B+{9 }  D}  
9 B~ ~,kk ~3B+{> 
9 |,kh |,kj B~2@	+{N6|
1V+{D  |,kh  B~ x B}  |  ~ |,p}3B+{L }  D}  
9 B~ ~,kk ~3B+{Q 
9 |,kh |,kj B~2@	+{a6|
1V+{V  |,kh  B~ x B}  |  ~ |,p}3B+{^ }  D}  
9 B~ ~,kk ~3B+{c 
9 |,kh |,kj B~2@	+{s6|
1V+{i+ |,kh  B~ x B}  |
9 B~ ~,kk ~3B+{v 
9 |,kh |,kj B~2@	+|6|
1V+{{,,|,kh,,B~,x,B},,|,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, L
 e,kj B2@	+~
 ,jG 
 B~ D~   ],pw ~  B~ ,kk ~ B3Bd+~  e,kh+~ 
x L
 e,kj B2@	+~ ,jG 
 B~ D~   \,pw ~  B~ ,kk ~ B3Bd+~  e,kh+~ 
x L
 e,kj B2@	+~' ,jG 
 B~ D~   \,pw ~  B~ ,kk ~ B3Bd+~+  e,kh+~, 
x L
 e,kj B2@	+~6 ,jG 
 B~ D~   [,pw ~  B~ ,kk ~ B3Bd+~9  e,kh+~: 
x L
 e,kj B2@	+~D ,jG 
 B~ D~   [,pw ~  B~ ,kk ~ B3Bd+~H  e,kh+~I 
x L
 e,kj B2@	+~S ,jG 
 B~ D~   Z,pw ~  B~ ,kk ~ B3Bd+~V  e,kh+~W 
x L
 e,kj B2@	+~a ,jG 
 B~ D~   Z,pw ~  B~ ,kk ~ B3Bd+~e  e,kh+~f 
x L
 e,kj B2@	+~p ,jG 
 B~ D~   Y,pw ~  B~ ,kk ~ B3Bd+~s  e,kh+~t 
x L
 e,kj B2@	+~~ ,jG 
 B~ D~   Y,pw ~  B~ ,kk ~ B3Bd+  e,kh+ 
x L
 e,kj B2@	+
 B~ D~   X,pw ~  B~ ,kk ~ B3Bd+  e,kh+ 
x L
 e,kj B2@	+ ,jG 
 B~ D~   X,pw ~  B~ ,kk ~ B3Bd+  e,kh+  
x L
 e,kj B2@	+* ,jG 
 B~ D~   W,pw ~  B~ ,kk ~ B3Bd+-  e,kh+. 
x L
 e,kj B2@	+8 ,jG 
 B~ D~   W,pw ~  B~ ,kk ~ B3Bd+<  e,kh+= 
x L
 e,kj B2@	+G ,jG 
 B~ D~   V,pw ~  B~ ,kk ~ B3Bd+J  e,kh+K 
x L
 e,kj B2@	+U ,jG 
 B~ D~   V,pw ~  B~ ,kk ~ B3Bd+Y  e,kh+Z 
x L
 e,kj B2@	+d ,jG 
 B~ D~   U,pw ~  B~ ,kk ~ B3Bd+g  e,kh+h 
x L
 e,kj B2@	+r ,jG 
 B~ D~   U,pw ~  B~ ,kk ~ B3Bd+v  e,kh+w 
x L
 e,kj B2@	+ ,jG 
 B~ D~   T,pw ~  B~ ,kk ~ B3Bd+  e,kh+ 
x L
 e,kj B2@	+ ,jG 
 B~ D~   T,pw ~  B~ ,kk ~ B3Bd+  e,kh+ 
x L
 e,kj B2@	+ ,jG 
 B~ D~   S,pw ~  B~ ,kk ~ B3Bd+!  e,kh+" 
x L
 e,kj B2@	+, ,jG 
 B~ D~   S,pw ~  B~ ,kk ~ B3Bd+0  e,kh+1 
x L
 e,kj B2@	+; ,jG 
 B~ D~   R,pw ~  B~ ,kk ~ B3Bd+>  e,kh+? 
x L
 e,kj B2@	+I ,jG 
 B~ D~   R,pw ~  B~ ,kk ~3Bd+L  e,kh+M 
x L
 
x L
 d B ,kk >},~|||||||||||| |!|"|#|$|&|'|(|*|+|,|-|.|/|0|1|2|4<
|5|6<	C<
<
<
<~<
<<})TTE(TTE#INT.NE.==NT.EQ.<INT.LT.<=NT.LE.>INT.GT.>=NT.GE..XOR.N*.NEQV.*.EQV.N*.OR..AND.N*.NOT.N*/TTE*TTE+TTE-TTE^INT**TE//TE.FALSE.OM.TRUE.OM<>
<>
	
g


g





<>


<>

f<@<	C<@:0FO


<	B

<@<>

<@<=


,PEA<	B<@> Bx  B H,kj B2@	+3 G,kj B~2@	+0641V+&  G,kh  B~ x B}  B}  ~ G,p|3B+. }  D}  
9 B~ ~,kk ~3B+3 
9 H,kh G,kj B~2@	+C641V+8  G,kh  B~ x B}  B}  ~ F,p|3B+A }  D}  F} 
9 B~ ~,kk ~3B+F 
9 H,kh G,kj B~2@	+V641V+K  G,kh  B~ x B}  B}  ~ F,p|3B+T }  D}  F} 
9 B~ ~,kk ~3B+Y 
9 H,kh G,kj B~2@	+i641V+^  G,kh  B~ x B}  B}  ~ E,p|3B+g }  D}  F} 
9 B~ ~,kk ~3B+l 
9 H,kh G,kj B~2@	+641V+q  G,kh  B~ x B}  B}  ~ E,p|3B+z }  D}  F} } } ~ D,p{ B}    ~ D,p{ B}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+641V+  G,kh  B~ x B}   ~ C,p|3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+(641V+  G,kh  B~ x B}  C  ~ C,p}3B+% }  D}  
9 B~ ~,kk ~3B+* 
9 H,kh G,kj B~2@	+:641V+0  G,kh  B~ x B}  B  ~ B,p}3B+8 }  D}  
9 B~ ~,kk ~3B+= 
9 H,kh G,kj B~2@	+M641V+B  G,kh  B~ x B}  B  ~ B,p}3B+J }  D}  
9 B~ ~,kk ~3B+O 
9 H,kh G,kj B~2@	+_641V+U  G,kh  B~ x B}  A  ~ A,p}3B+] }  D}  
9 B~ ~,kk ~3B+b 
9 H,kh G,kj B~2@	+r641V+g  G,kh  B~ x B}  A  ~ A,p}3B+o }  D}  
9 B~ ~,kk ~3B+t 
9 H,kh G,kj B~2@	+641V+z  G,kh  B~ x B}  @  ~ @,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+641V+
  G,kh  B~ x B}  @  ~ @,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+)641V+  G,kh  B~ x B}  ?  ~ ?,p}3B+' }  D}  
9 B~ ~,kk ~3B+, 
9 H,kh G,kj B~2@	+<641V+1  G,kh  B~ x B}  ?  ~ ?,p}3B+9 }  D}  
9 B~ ~,kk ~3B+> 
9 H,kh G,kj B~2@	+N641V+D  G,kh  B~ x B}  >  ~ >,p}3B+L }  D}  
9 B~ ~,kk ~3B+Q 
9 H,kh G,kj B~2@	+a641V+V  G,kh  B~ x B}  >  ~ >,p}3B+^ }  D}  
9 B~ ~,kk ~3B+c 
9 H,kh G,kj B~2@	+s641V+i  G,kh  B~ x B}  =  ~ =,p}3B+q }  D}  
9 B~ ~,kk ~3B+v 
9 H,kh G,kj B~2@	+641V+{  G,kh  B~ x B}  =  ~ =,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+641V+  G,kh  B~ x B}  <  ~ <,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	++641V+   G,kh  B~ x B}  <  ~ <,p}3B+( }  D}  
9 B~ ~,kk ~3B+- 
9 H,kh G,kj B~2@	+=641V+3  G,kh  B~ x B}  ;  ~ ;,p}3B+; }  D}  
9 B~ ~,kk ~3B+@ 
9 H,kh G,kj B~2@	+P641V+E  G,kh  B~ x B}  ;  ~ ;,p}3B+M }  D}  
9 B~ ~,kk ~3B+R 
9 H,kh G,kj B~2@	+b641V+X  G,kh  B~ x B}  :  ~ :,p}3B+` }  D}  
9 B~ ~,kk ~3B+e 
9 H,kh G,kj B~2@	+u641V+j  G,kh  B~ x B}  :  ~ :,p}3B+r }  D}  
9 B~ ~,kk ~3B+w 
9 H,kh G,kj B~2@	+641V+}  G,kh  B~ x B}  9  ~ 9,p}3B+ }  D}  
9 B~ ~,kk ~3B+
 
9 H,kh G,kj B~2@	+641V+  G,kh  B~ x B}  9  ~ 9,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+,641V+"  G,kh  B~ x B}  8  ~ 8,p}3B+* }  D}  
9 B~ ~,kk ~3B+/ 
9 H,kh G,kj B~2@	+?641V+4  G,kh  B~ x B}  8  ~ 8,p}3B+< }  D}  
9 B~ ~,kk ~3B+A 
9 H,kh G,kj B~2@	+Q641V+G  G,kh  B~ x B}  7  ~ 7,p}3B+O }  D}  
9 B~ ~,kk ~3B+T 
9 H,kh G,kj B~2@	+d641V+Y  G,kh  B~ x B}  7  ~ 7,p}3B+a }  D}  
9 B~ ~,kk ~3B+f 
9 H,kh G,kj B~2@	+v641V+l  G,kh  B~ x B}  6  ~ 6,p}3B+t }  D}  
9 B~ ~,kk ~3B+y 
9 H,kh G,kj B~2@	+	641V+~  G,kh  B~ x B}  6  ~ 6,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+641V+  G,kh  B~ x B}  5  ~ 5,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 H,kh G,kj B~2@	+-641V+#  G,kh  B~ x B}  5  ~ 5,p}3B++ }   
9 B~ ~,kk ~3B+0 
9 H,kh 
 L  B~ ,kk ~>|,~<x
f
g
h
i
j
k
l
m
n
o
p
q
r
s
t
u
w
x
y
{
|
}
~





<


<	C<
<
<
<
<<}NE.EEQ.ELE.ELT.EGE.EGT.EXOR.NOT.EQV.NEQV.NOTOR.EAND.> 
 Bx ,kj B2@	+
 ,kj B2@	+c ,jG 
 B~ D~   ,pw ~  B~ ,kk ~3B+f  ,kh+g 
x L
 ,kj B2@	+q ,jG 
 B~ D~   ,pw ~  B~ ,kk ~ B3B+u  ,kh+v 
x L
 ,kj B2@	+ ,jG 
 B~ D~   ,pw ~  B~ ,kk ~ B3B+  ,kh+ 
x L
 ,kj B2@	+ ,jG 
 B~ D~   ,pw ~  B~ ,kk ~ B3B+  ,kh+ 
x L
 ,kj B2@	+ ,jG 
 B~ D~   ,pw ~  B~ ,kk ~ B3B+   ,kh+! 
x L
 ,kj B2@	++ ,jG 
 B~ D~   ,pw ~  B~ ,kk ~ B3B+/  ,kh+0 
x L
 ,kj B2@	+: ,jG 
,B~ D~   ,kk ~ B3B+=  ,kh+> 
x L
 ,kj B2@	+H ,jG 
,B~ D~   ,kk ~ B3B+L  ,kh+M 
x L
 ,kj B2@	+W ,jG 
 B~ D~   
,pw ~  B~ ,kk ~ B3B+Z  ,kh+[ 
x L
 ,kj B2@	+e ,jG 
 B~ D~   
,pw ~  B~ ,kk ~ B3B+i  ,kh+j 
x L
 ,kj B2@	+t ,jG 
 B~ D~   ,pw ~  B~ ,kk ~ B3B+w  ,kh+x 
x L
 ,kj B2@	+ ,jG 
 B~ D~   ,pw ~  B~ ,kk ~3B+  ,kh+ 
x L
 
x L
  B ,kk >},~
H
I
J
K
L
M
N
O
P
Q
S<~
T<<}NE.EEQ.ELE.ELT.EGE.EGT.EXOR.NOT.EQV.NEQV.NOTOR.EAND.> Bx  B 
,kj B2@	+
 
,kj B~2@	+46
1V+)  
,kh  B~ x B}  
  ~ 
,p}3B+1 }  D}  
9 B~ ~,kk ~3B+6 
9 
,kh 
,kj B~2@	+F6
1V+<  
,kh  B~ x B}  
  ~ 
,p}3B+D }  D}  
9 B~ ~,kk ~3B+I 
9 
,kh 
,kj B~2@	+Y6
1V+N  
,kh  B~ x B}  
  ~ 
,p}3B+V }  D}  
9 B~ ~,kk ~3B+[ 
9 
,kh 
,kj B~2@	+k6
1V+a  
,kh  B~ x B}  

  ~ 

,p}3B+i }  D}  
9 B~ ~,kk ~3B+n 
9 
,kh 
,kj B~2@	+~6
1V+s  
,kh  B~ x B}  

  ~ 

,p}3B+{ }  D}  
9 B~ ~,kk ~3B+	 
9 
,kh 
,kj B~2@	+	6
1V+	  
,kh  B~ x B}  
	  ~ 
	,p}3B+	 }  D}  
9 B~ ~,kk ~3B+	 
9 
,kh 
,kj B~2@	+	#6
1V+	  
,kh  B~ x B}  
	  ~ 
	,p}3B+	  }  D}  
9 B~ ~,kk ~3B+	% 
9 
,kh 
,kj B~2@	+	56
1V+	+  
,kh  B~ x B}  
  ~ 
,p}3B+	3 }  D}  
9 B~ ~,kk ~3B+	8 
9 
,kh 
,kj B~2@	+	H6
1V+	=  
,kh  B~ x B}  
  ~ 
,p}3B+	E }  D}  
9 B~ ~,kk ~3B+	J 
9 
,kh 
,kj B~2@	+	Z6
1V+	P  
,kh  B~ x B}  
  ~ 
,p}3B+	X }  D}  
9 B~ ~,kk ~3B+	] 
9 
,kh 
,kj B~2@	+	m6
1V+	b  
,kh  B~ x B}  
  ~ 
,p}3B+	j }  D}  
9 B~ ~,kk ~3B+	o 
9 
,kh 
,kj B~2@	+	6
1V+	u  
,kh  B~ x B}  
  ~ 
,p}3B+	| }   
9 B~ ~,kk ~3B+
 
9 
,kh 
 L  B~ ,kk ~>},~<x











<<} +t;> Bx,jG  B D2@+
 +     D    B~ D~ F} H}   D| D|  B{3B+
 +
  
92B+
# 
96	1V+
# 3B+
]   D|3B
+
( +
( 
93B+
]6	0V+
S  B{  D|   B{ D{ D{  Bz3B+
2 +
3 
92B+
6 
96
1V+
6 3B+
S  Bz  D{3B+
; +
< 
93B+
S6	0V+
P  Bz  D{   Bz Dz Dz  By3B+
F +
F 
92B+
J 
96
1V+
J 3B+
Q  By  Dz Z,k3B+
Q 
93@z+
Q 3B+
S 
9+
S 3B+
]3@|+
Z |  B{ |  D| B} 
9+
Z 3B+
] 
93@|+
] 3B+
` 

9 L+
 ~  B| D| D|  B{3B+
e +
f 
92B+
i 
96	1V+
i 3B+  B{  D|3B+
n +
o 
93B+3D+
t  B{  D| B} 
9+
u 3B+3D+
z  B{  D| B~ 
9+
{ 3B+3D+  B{  D| B} 
9+ 3B+ 
93D+ 3B+
  },j< B+
 >y,~<{<<z<y<
3<
1<
2<
<@>	 Bx D F,jG  B~ D~2@~+ +Z ~  ~  D~ @| 
    B} D} F| H| J{ 
| L{   Dz Dz  By3B+" +# 
92B+& 
96[1V+& 3B+q   Dz3Bd++ ++ 
93B+q ,jG By3@z+I 
z6\0V+G z   By Dx Dy  Bx3B+7 +7 
92B+; 
96\1V+; 3B+H  Bx  Dx3Bc+@ +@ 
93B+H3D+D  Dx 
9+E 3B+H 
93D+H 3B+K y  B} 
9+P z  z  Dz  y,jG By+.3B+q6]0V+m z  By z  Dz   By Dy Dy  Bx3B+[ +\ 
92B+_ 
96]1V+_ 3B+n  Bx  Dy3Bc+d +e 
93B+n3D+j  Bx  Dy B| 
9+k 3B+n 
93D+n 3B+q 
93@z+q 3B+
"3@+
3@}+
 ,ji BZ&  d"p:l" df  Bz 
} Lz6^0V+~ z +  Bz6^0V+
 z  ,kt z  Bz6^0V+
 +
  Bz+  | 
,k ,ji BZ&  d"p:l" df+  Bz 
} Lz6^0V+
 z +
  Bz6^0V+
 z  ,kt z  Bz6^0V+
 +
  Bz+
  | 
,k+ }  Bz Dz Dz  By3B+
' +
( 
92B+
+ 
96[1V+
+ 3B+ Dz3Bd+
0 +
1 
93B+jG By3@z+
} 
z6\0V+
{ z   By Dx Dy  Bx3B+
< +
= 
92B+
@ 
96\1V+
@ 3B+
|  Bx  Dx3Bc+
E +
F 
93B+
|6_0V+
\  Bx  Dx   Bx Dw Dx  Bw3B+
P +
P 
92B+
T 
96_1V+
T 3B+
\  Bw  Dw3Bc+
Y +
Y 
93B+
\ 
93D+
\ 3B+
|3@x+
a x  Bx 
9+
a 3B+
|6]0V+
x x  Bx x  Dx   Bx Dw Dx  Bw3B+
l +
m 
92B+
p 
96_1V+
p 3B+
y  Bw  Dw3Bb+
u +
v 
93B+
y 
93D+
y 3B+
| 
93@x+
| 3B+
 y  B} 
9+z  By z  Dz  y,jG By+
33B++y z  Dz   By Dy Dy  Bx3B+
92B+
96]1V+ Dy3Bc+
93B++ Dy   Bx Dx Dx  Bw3B+
92B+
96`1V+ Dx3Bc+
93B+
93D++x y  Dy B{ 
9+3B+x y  Dy   Bx Dx Dx  Bw3B+
92B+
96`1V+ Dx3Bb+
93B+
93D++
93@y++
93@z++
}Lz6^0V++z dBz6^0V+f   {, ,ji BZ&  d"p:l" df+ }  Bz Dz Dz  By3B+
92B+
96[1V+\  By  Dz3Bd+ + 
93B+\ ,jG By3@z+' 
z6\0V+& z   By Dx Dy  Bx3B+
 +
92B+ 
96\1V+ 3B+&  Bx  Dx3Bb+ + 
93B+&3D+  Dx 
9+ 3B+&3D+  Dx 
9+ 3B+&3D+#  Dx 
9+# 3B+& 
93D+& 3B+* y  B} 
9+/ z  By z  Dz  y,jG By+3B+\6]0V+X z  By z  Dz   By Dy Dy  Bx3B+: +; 
92B+> 
96]1V+> 3B+Y  Bx  Dy3Bb+C +D 
93B+Y3D+I  Bx  Dy B| 
9+J 3B+Y3D+O  Bx  Dy B{ 
9+P 3B+Y3D+U  Bx  Dy B{ 
9+V 3B+Y 
93D+Y 3B+\ 
93@z+\ 3B+3@+}3@}+} ,ji BZ&  d"p:l" df  Bz 
} Lz6^0V+i z +j  Bz6^0V+s z  ,kt z  Bz6^0V+r +r  Bz+j { { | b,jn  , ,ji BZ&  d"p:l" df+  Bz 
} Lz6^0V+ z +  Bz6^0V+
 z  ,kt z  Bz6^0V+ +  Bz+ { { | b,jn  ,+ }  Bz Dz Dz  By3B+ + 
92B+ 
96[1V+ 3B+L  By  Dz3Bb+ +  
93B+L3D+%  By  Dz B| 
9+& 3B+L6_0V+B  By  Dz   By Dy Dy  Bx3B+0 +0 
92B+4 
96]1V+4 3B+B  Bx  Dy3Ba+9 +9 
93B+B3D+?  Bx  Dy B{ 
9+? 3B+B 
93D+B 3B+L3@z+I z  By z  Dz B{ 
9+I 3B+L 
93@z+L 3B+ a { ,k3B+S |,t;3B+S 
9+T   |,  { 
,k   {,+ ~>v,~<y<0<x<z<x<z<<<w<w<y

<
2<
3<<<
4<
2<
j<
K<@<
<<@<|<@<{<@<<@<<@P$PARSEfa*NEXT-SYMBOL* D20FOR_FOREXPR*P$ERROR-RUNTIME inP$<EMPTY>CADRS<EMPTY>>C*P$ERRORCD20FOR$BACKUP-MARK*INPUT-SYMBOL*
ARITHMETIC-EXPRESSIONs eD20FOR$ARITHMETIC-EXPRESSION-PRINTARITHMETIC-CONSTANT-EXPRESSIONESSID20FOR$ARITHMETIC-CONSTANT-EXPRESSION-PRINTo	CHARACTER-EXPRESSIONESSID20FOR$CHARACTER-EXPRESSION-PRINTKCHARACTER-CONSTANT-EXPRESSIOND20FOR$CHARACTER-CONSTANT-EXPRESSION-PRINTo
D20FOR$LOGICAL-EXPRESSIONNPLOGICAL-EXPRESSIONED20FOR$LOGICAL-EXPRESSION-PRINTOKED20FOR$LOGICAL-CONSTANT-EXPRESSION
RELATIONAL-EXPRESSIONESSD20FOR$RELATIONAL-EXPRESSION-PRINTGENERAL-EXPRESSION-D20FOR$GENERAL-EXPRESSION-PRINTNTD20FOR$VARIABLERAL-D20FOR$R-PAREND20FOR$L-PAREN
D20FOR$STRING-CONSTANTEN.TRUE.A.FALSE.AD20FOR$NUMERIC-CONSTANTN
D20FOR$BINARY-OPERATORN
D20FOR$UNARY-OPERATORND20FOR_PRIMARYD20FOR_EXPRESSIONSTD20FOR_UNARY-OPS in
D20FOR_UNARY-EXPR!5*15 %
D20FOR_UNARY-EXPR!5*16 %UNARY-EXPR!5*15RATOUNARY-EXPR!5*16RATO	D20FOR_UNARY-EXPR!5UNARY-EXPR!5*D20FOR_UNARY-EXPR5*D20FOR_BINARY-OP in	D20FOR_EXPRESSION!1EXPRESSION!1*FOREXPRYMP$ERROR-MESSAGERK
*LEXEME-INPUT-SOURCE*t %>,t= ,kj Bx2@	+,t= B x,kk >,~<
M3B+  ,~<
N<{

M<@    ,jf  +jm<<w

 
 B^-4kN
O,t--4kP B_,~ $-4kN
<,t<3B+   ,t  #,jm+  # 
^ L
-4kP,~<~<
P<
C6*1V+' ,~ +  ,t: 
9,~<<
D 6-4kN
<,t<3B+2  ,t  6,jm+3 5 
^ L
-4kP,~<~<
Q<
C6=1V+: ,~ =  ,t: 
9,~<<
E I-4kN
<,t<3B+E  ,t  H,jm+E H 
^ L
-4kP,~<~<
R<.6O1V+L ,~ P  ,t: 
9,~<<
E [-4kN
<,t<3B+W  ,t  [,jm+X Z 
^ L
-4kP,~<~<
S<
6b1V+_ ,~ b  ,t: 
9,~<<
F n-4kN
<,t<3B+j  ,t  m,jm+j m 
^ L
-4kP,~<~<
T<
B6t1V+q ,~ u  ,t: 
9,~<<
F -4kN
<,t<3B+|  ,t  ,jm+}  
^ L
-4kP,~<~<
V<
B61V+ ,~   ,t: 
9,~<<
G -4kN
<,t<3B+  ,t  ,jm+  
^ L
-4kP,~<~<
W<
A61V+ ,~   ,t: 
9,~<<
H %-4kN
<,t<3B+!  ,t  %,jm+" $ 
^ L
-4kP,~<~<
X<
A6,1V+) ,~ ,  ,t: 
9,~<<
H<
P
.<
R
/<
T<@ 6]1V+3 +4 
93B+] 6]1V+8 +8 
93B+] 
b2LL+>  2Bb+\ 
9,~ 
a2LL+B  2Bb+\ 
9,~ 
a2LL+G  2Bb+\ 
9,~ 
`2LL+K  2Bb+\ 
9,~ 
`2LL+P  2Bb+\ 
9,~ 
_2LL+T  2Bb+\ 
9,~ 
_2LL+X ^  +k 
^2LL+\  2Bb+\ 
9,~ ,~<<
A
-<
A<
B<
B<
<.<
C<
<
C  L 
92Do+f 3B+n 
96n1V+j 3B+n 3Bo+m ,~ 
9,~<<<
A  L 
92D|+s 3B+{ 
96{1V+w 3B+{ 3B|+z ,~ 
9,~<<<
A<

~<
<@ 6 1V+ + 
93B+  6 1V+ + 
93B+  
%2LL+%+ 
9,~ 
$3LL+ 
$2LL+  2B#+ 
9,~ 
#2LL+  2B#+ 
9,~ 
#3LL+ 
"3LL+ 
"3LL+ 
!2LL+ !  +k ,~<
}<
A<
A<
B<
B<
<.<
C<
<
C<
[
(<

)<
\<@<

*<

+<

,<
<@ 6W1V+0 +1 
93B+W 
]2LL+86X0V+7 \  +k \ +k 
[2LL+>6X0V+= \  +V ,~ 
[3LL+V 
Z3LL+V 
Z2LL+H6X0V+F \  +k \ +k 
Y2LL+N6X0V+M \  +k \ +k 
Y3LL+V 
X2LL+V6X0V+U \  +k \ +k ,~<<<
A<
A<
B<
B<
<.<
C
&
'<
C<
5
a<
8
b<
9
c<
5
d</
e<
8
f<
:
g</
h<
i<
6
j<
;
k<
l<
m<
7
n<
;
o<
p<
q<
7
r<
:<@<
s<
t<
9
u<<@<
5
v<
w<
9
x<:
y<
:
z<
{<
;
|<:
}<
;
~<
6
<
:
<<@<:
<
<
<:
<
6
<
<
8
<
8
<
6
	<
7

<
7
<
9<@ 6,1V+ + 
93B+, 
32LL+ 2 +k 
22LL+ 2 +k 
12LL+ 2B1++ 
9,~ 
02LL+ 2B1++ 
9,~ 
02LL+" / +k 
/2LL+% / +k 
.2LL+( . +k 
-2LL++ - +k ,~<
]<
A
^<
A<
B
_<
B<
<
5<.<
C
`<
C<
5<
6<
7<<@<
1<@ 6T1V+< +< 
93B+S 
Y2LL+@ Y +k 
X2LL+C Y +k 
X3LL+S 
W3LL+S 
W2LL+J 2BV+S 
9,~ 
V2LL+N 2BV+S 
9,~ 
U3LL+S 
U2LL+S T +k ,~<
3<
A<
A<
B<
1<
B<
<.<
C
4<
C> _,tJ3B+b  ,jG Bx _,jG Bx,t= x + _,tL3B+j  ,jG Bx _,jG Bx,t= x + _,tM3B+q  ,jG Bx _,jG Bx,t= x + _,tK3B+  ,jG Bx _,jG Bx,t=,tO  x,jG Bx _,tK3B+ _ x,jG Bx,t=+  ,kh x +  >+kh>,~<
M<
4> _,tN3B+  ,jG Bx _,jG Bx,t= x +  >+kh>,~<
M<
1> _,tN3B+- 3 ,jG Bx,tP  x,jG Bx,tQ B3B2+,  B   B600V+! +!  B~611V+$ +, ~ x,jG Bx   D610V+* ++  B~+" x +/  2>~+kh>~,~<<<<
M<
N<
`> _,tN3B+J M ,jG Bx  B,tP  B6K0V+= +>  B6L1V+A +H  x,jG Bx   D6L0V+G +G  B+> x +J M>~,~<<<<
N<
a> _,tN3B+d h ,jG Bx  B,tP  B6f0V+X +X  B6f1V+[ +c  x,jG Bx   D6g0V+a +b  B+Y x +e g>~,~<<<<
N<
b> _,tJ2B+u _,tK2B+u _,tL2B+u _,tM2B+u _,tN2B+u 
2L_+
  ,jG Bx,tR B3B+	  B   B60V+~ +~  B~61V+ +	 ~ x,jG Bx   D60V+ +  B~+,tO  x,jG +  >~+kh>~,~<<<<
M<
2<
N> _,tN3B+  ,jG Bx _,jG Bx,t= x +  >+kh>,~<
M<
2> _,tN3B+) + ,jG Bx,tT  x,jG Bx,tO  x,jG +) *>,~<
N<
d> _,tJ2B+6 _,tK2B+6 _,tL2B+6 _,tM2B+6 _,tN3B+N T ,jG Bx,tS  x,jG Bx,tT B3BS+M  B   B6Q0V+B +B  B~6R1V+E +M ~ x,jG Bx   D6R0V+K +L  B~+C x +P  S>~+kh>~,~<<<<
M<
N<
4> _,tJ2B+_ _,tK2B+_ _,tL2B+_ _,tM2B+_ _,tN3B+d h ,jG Bx,tO  x,jG +f  g>+kh>,~<
M<
dRule %w failed on input %w.%n<
e<@<
O<@<|<@<
<<@TOMAASSIGNO-<>
~)0FO<>
<
(RMA<>
*RMAACCEPTEN=0FO<>
<>



<@<
(


~
v
	
v

<
<
*<@<=

<
'
,T*

<	B

<@

<
)
<>




 RMA

<
%<@<	C<@:0FO

<>

s<@
u<@
<@<=


<	B<@> 
 Bx ",kj B2@	+ ",kj B2@	+4 ,jG 
 B~ D~   !,pw ~ ~ !,pv ~ ~  ,pv ~ ~  ,pw ~ ~ ,pw ~  B~ ,kk ~ B3B+:,pk3B+:   ",kh+; 
x L
 ",kj B2@	+I ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+N,pk3B+N   ",kh+O 
x L
 ",kj B2@	+] ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+c,pk3B+c   ",kh+d 
x L
 ",kj B2@	+x ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ ,pt ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+},pk3B+}   ",kh+~ 
x L
 ",kj B2@	+ ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ ,pw ~ ~ !,pw ~  B~ ,kk ~ B3B+,pk3B+   ",kh+ 
x L
 
x L
  B ,kk >},~
p<

q
r
s
t
u
v
w
x
y<~<	B
{
|
}<	C<<}TOMAASSIGNO-<>
2)0FO<>
3<
(
4(RMA<>
5*RMA RMAACCEPTEN=0FO<>
6<>
7
8
9
:<@<
'
;
<
2
)
=
)
><
?<
*<@<=
@<
)
A,T*
B
C<	B
D
,<@
<
E<
%<@<>
F
G
H
I
J
8
K<	C<@:0FO
B
J<>
L
&<@
M<@
N<@<
(<=
O
<
P<	B<@> Bx  B ,kj B2@	+ ,kj B~2@	+y61V+[  ,kh  B~ x B}  B}  ~ ,p|3B+d }  D}  F} } } ~ ,p{ B}  D}   ~ ,p{ B}  D}   ~ ,p}3B+r }  D}  F} } ~ ,p|3B+w }  D}  
9 B~ ~,kk ~3B+| 
9 ,kh ,kj B~2@	+61V+  ,kh  B~ x B}  B}   ~ ,p}3B+
 }  D}  F} ,p|  } ~ ,p}3B+ }  D}  F} } } ~ ,p{ B}  D} 
9 B~ ~,kk ~3B+ 
9 ,kh ,kj B~2@	+661V+   ,kh  B~ x B}  B}   ~ ,p}3B+) }  D}  F} ,p| } ~ ,p|3B+/ }  D}  F} } } ~ ,p{ B}  D} 
9 B~ ~,kk ~3B+8 
9 ,kh ,kj B~2@	+b61V+>  ,kh  B~ x B}  B}   ~ ,p}3B+G }  D}  F} ,p|  } ~ ,p}3B+N }  D}  F} } ~ ,pz B}  D}   ~ ,p{ B}  D}   ~ ,p}3B+[ }  D}  F} } } ~ ,p{ B}  D} 
9 B~ ~,kk ~3B+d 
9 ,kh ,kj B~2@	+61V+j  ,kh  B~ x B}  B}   ~ ,p}3B+s }  D}  F} ,p| } ~ ,p|3B+y }  D}  F} ,p|  } ~ ,p}3B+ }  D}  F} ,p| } ~ ,p|3B+ }   
9 B~ ~,kk ~3B+ 
9 ,kh 
 L  B~ ,kk ~>|,~<x
#<

$
%
&
'
(
)
*
+
,
-<	B
/
0
1<	C<<}<{<@<<@<|<@<>
+DATABLOCKNRI<>
,BACKSPACE)0FO<>
-<
.(RMABACKFILEN=0FO<>
/<>
0
1
2
3<@
4<@<
(
5
%
6
%
7<
8<	C<@<=
9<=
:<
)
;
<
=<	B
>
?<@
@
A
@
B<
"<@<>
C
D
E
F
G RMA,PEA
1
H
1
I<	C<@:0FO
<
G<>
J
"<@
K<@
L<@
M<@<
N<
O<=
P<
(
Q<
(
R
@
S<
!
T<
)
U<	B<@<
)<@<
!<@> 
 Bx k,kj B2@	+a j,kj B2@	+l ,jG 
 B~ D~   j,pw ~ ~ i,pv ~ ~ i,pv ~ ~ h,pw ~ ~ h,pw ~  B~ ,kk ~ B3Bg+r,pk3B+r   k,kh+s 
x L
 j,kj B2@	+ ,jG 
 B~ D~   g,pw ~ ~ f,pw ~ ~ f,pt ~ ~ e,pv ~ ~ e,pw ~  B~ ,kk ~ B3Bg+
,pk3B+
   k,kh+ 
x L
 j,kj B2@	+ ,jG 
 B~ D~   g,pw ~ ~ d,pw ~  B~ ,kk ~ B3Bg+,pk3B+   k,kh+ 
x L
 j,kj B2@	+0 ,jG 
 B~ D~   d,pw ~ ~ f,pw ~ ~ f,pt ~ ~ c,pv ~ ~ e,pw ~  B~ ,kk ~ B3Bg+5,pk3B+5   k,kh+6 
x L
 j,kj B2@	+B ,jG 
 B~ D~   d,pw ~ ~ d,pw ~  B~ ,kk ~ B3Bg+H,pk3B+H   k,kh+I 
x L
 j,kj B2@	+W ,jG 
 B~ D~   c,pw ~ ~ b,pw ~ ~ b,pv ~  B~ ,kk ~ B3Bg+\,pk3B+\   k,kh+] 
x L
 
x L
 g B ,kk >},~



 
!<	C
"
#
$
%
&<~<	B
(
)
*<	C<<}<>
{DATABLOCKNRI<>
|BACKSPACE)0FO<>
}<
(
~(RMA RMABACKFILEN=0FO<>
<>



<@
<@<
)

t

t
<
<	C<@<=
	<=

<
"<@


<	B

u<@



<>




,PEA



<	C<@:0FO

<>

q<@
<@
<@
<@<
<
<=
<
(
<
(
 

!<
!
"<
)
#<	B<@<
)<@<
!<@> Bx  B },kj B2@	+s },kj B~2@	+L6t1V+.  },kh  B~ x B}  B}  ~ |,p|3B+7 }  D}  F} } } ~ |,p{ B}  D}   ~ {,p{ B}  D} {  ~ {,p}3B+E }  D}  F} } ~ z,p|3B+J }  D}  
9 B~ ~,kk ~3B+O 
9 },kh },kj B~2@	+t6t1V+T  },kh  B~ x B}  B} z  ~ z,p}3B+] }  D}  F} y,p| y } ~ y,p}3B+d }  D}  F} } ~ x,pz B}  D}   ~ x,p{ B}  D} w  ~ w,p}3B+r }  D}  F} 
9 B~ ~,kk ~3B+w 
9 },kh },kj B~2@	+6t1V+|  },kh  B~ x B}  B} z  ~ z,p}3B+ }  D}  F} y,p| } ~ w,p|3B+
 }  D}  F} 
9 B~ ~,kk ~3B+ 
9 },kh },kj B~2@	+66t1V+  },kh  B~ x B}  B} v  ~ v,p}3B+ }  D}  F} y,p| y } ~ y,p}3B+& }  D}  F} } ~ x,pz B}  D}   ~ v,p{ B}  D} w  ~ w,p}3B+4 }  D}  F} 
9 B~ ~,kk ~3B+9 
9 },kh },kj B~2@	+P6t1V+>  },kh  B~ x B}  B} v  ~ v,p}3B+G }  D}  F} y,p| } ~ w,p|3B+N }  D}  F} 
9 B~ ~,kk ~3B+S 
9 },kh },kj B~2@	+m6t1V+X  },kh  B~ x B}  B} u  ~ u,p}3B+a }  D}  F} u } ~ u,p}3B+g }  D}  F} } } ~ t,p{  
9 B~ ~,kk ~3B+o 
9 },kh 
 L  B~ ,kk ~>|,~<x
k
l
m
o
p<	C
q
r
s
t
u
v<	B
x
y
z<	C<<}<{<@<<@<|<@	D20FOR$CLOSE-OPTIONSNDSD20FOR$LAST-UPPER-BOUNDSD20FOR$CALL-LISTPRE
D20FOR$CLOSE-OPTIONS-PRINT
D20FOR$CALL-LIST-ITEMESS
D20FOR$CALL-LIST-PRINTCONTINUES<>
/COMPLEXAS<=
0COMMONLO)0FO<>
1<
2(RMACLOSENYP<>
3<>
4<>
5<>
6FUNCTIONP<>
7CHARACTER<>
8CALL=0FO<>
9<>
:
;<@
<
=
><@<
f
?
@<@
A
B<	D
C
 
D<	D<@
 
E
 
F
 
G<=
H<>
I
J
K<=
L<	C<@<=
M<
N
 
O
<<@
P
Q
R
Q
S
T<	B
U
V
W
V<@<>
X<	C
Y
V
Z
V
[
\<@
]
^<>
_
<@<>
`<>
?
a
b
c
Q,PEA
A
d
A
e
f
g
A
h
A
i RMA<>
j<
f
k<	F<@<
g<@:0FO
S
Q<>
l<	C
m
n
o<>
B
p<@<
f<@<	C
q<	C
r
s
Q
t<@
(
u/RMA
v
w<>
x
#
y
a<@<>
z<=
{
#<@<>
|
n<@
}<@
(<@
~<@
V
<	C<@<=
<=
<	B<@
V

V

A

A
<	C
u
]
<
f<@> 
 Bx  l,kj B2@	+ ^  k,kj B2@	+ ,jG 
 B~ D~    k,pw ~ ~  j,pv ~ ~  j,pv ~ ~  i,pw ~ ~  i,pw ~  B~ ,kk ~ B3B h+#,pk3B+#    l,kh+$ 
x L
  k,kj B2@	+2 ,jG 
 B~ D~    h,pw ~ ~  k,pw ~ ~  g,pv ~  B~ ,kk ~ B3B h+8,pk3B+8    l,kh+9 
x L
  k,kj B2@	+K ,jG 
 B~ D~    g,pw ~ ~  f,pv ~ ~  f,pw ~ ~  k,pw ~ ~  e,pv ~  B~ ,kk ~ B3B h+P,pk3B+P    l,kh+Q 
x L
  k,kj B2@	+e ,jG 
 B~ D~    g,pw ~ ~  e,pv ~ ~  k,pw ~ ~  d,pv ~ ~  f,pv ~ ~  d,pv ~  B~ ,kk ~ B3B h+k,pk3B+k    l,kh+l 
x L
  k,kj B2@	+~ ,jG 
 B~ D~    c,pw ~ ~  c,pw ~ ~  b,pt ~ ~  b,pv ~ ~  a,pw ~  B~ ,kk ~ B3B h+ ,pk3B+     l,kh+  
x L
  k,kj B2@	+  ,jG 
 B~ D~    a,pw ~ ~  `,pu ~  B~ ,kk ~ B3B h+ ,pk3B+     l,kh+  
x L
  k,kj B2@	+ ) ,jG 
 B~ D~    `,pw ~ ~  f,pv ~ ~  f,pw ~ ~  k,pw ~ ~  e,pv ~  B~ ,kk ~ B3B h+ .,pk3B+ .    l,kh+ / 
x L
  k,kj B2@	+ C ,jG 
 B~ D~    `,pw ~ ~  f,pv ~ ~  k,pw ~ ~  f,pv ~ ~  d,pv ~ ~  _,pv ~  B~ ,kk ~ B3B h+ I,pk3B+ I    l,kh+ J 
x L
  k,kj B2@	+ T ,jG 
 B~ D~    _,pw ~  B~ ,kk ~ B3B h+ Y,pk3B+ Y    l,kh+ Z 
x L
 
x L
  h B ,kk >},~








 
!
"
#
$
%
&
(
)
*
+<~<	B
,
-
.<	C<<}CONTINUES<>
!COMPLEXAS<=
!COMMONLO)0FO<>
!<
f
!	(RMACLOSENYP<>
!
<>
!<>
!
<>
!FUNCTIONP<>
!CHARACTER<>
! RMACALL=0FO<>
!<>
!
!<@
!
!
!<@<	C<@
!<@
!
!<	D
!
 v
!<	D<@
 v
!
 v
!
 v
!<=
!<>
!
! 
!!<=
!"<=
!#<
!$
 v
!%
!<@
!&
!'
!(
!'
!)
!*<	B
!+
!,
!-
!,<@<>
!.<	C
!/
!,
!0
!,
!1
!<@
!2
!3<>
!4
 s<@<>
!5<>
!	
!6
!7
!8
!',PEA
!
!9
!
!:
!;
!<
!
!=
!
!><>
!?<
f
!@<	F<@<
g<@:0FO
!)
!'<>
!A<	C
!B
!C
!D<>
!
!E<@<
f<@<	C
!F<	C
!G
!H
!'
!I<@
 ~
!J/RMA
!K
!L<>
!M
 y
!N
!6<@<>
!O<=
!P
 y<@<>
!Q
!C<@
!R<@
 ~<@
!S<@
!,
!T<	C<@<=
!U<=
!V<	B<@
!,
!W
!,
!X
!
!Y
!
!Z<	C
!J
!2
![<
f<@> Bx  B $.,kj B2@	+$ $-,kj B~2@	+"6$ 1V+!g  $-,kh  B~ x B}  B}  ~ $-,p|3B+!o }  D}  F} } } ~ $,,p{ B}  D}   ~ $,,p{ B}  D} $+  ~ $+,p}3B+!} }  D}  F} } ~ $+,p|3B+" }  D}  
9 B~ ~,kk ~3B+" 
9$.,kh$-,kjBB~2@	+"#6$ 1V+"  ~ $*,p}3B+" }  D}  F} $*,p| } ~ $-,p|3B+" }  D}  F} } } ~ $),p{ B}  D} 
9 B~ ~,kk ~3B+"% 
9 $.,kh $-,kj B~2@	+"L6$ 1V+"+  $-,kh  B~ x B}  B} $)  ~ $),p}3B+"4 }  D}  F} } } ~ $(,p{ B}  D} $*,p| $( } ~ $(,p}3B+"? }  D}  F} $*,p| } ~ $-,p|3B+"E }  D}  F} } } ~ $',p{ B}  D} 
9 B~ ~,kk ~3B+"N 
9 $.,kh $-,kj B~2@	+"v6$ 1V+"T  $-,kh  B~ x B}  B} $)  ~ $),p}3B+"] }  D}  F} } } ~ $',p{ B}  D} $*,p| } ~ $-,p|3B+"g }  D}  F} } } ~ $&,p{ B}  D}   ~ $(,p{ B}  D}   ~ $&,p{ B}  D} 
9 B~ ~,kk ~3B+"x 
9 $.,kh $-,kj B~2@	+#6$ 1V+"~  $-,kh  B~ x B}  B} $%  ~ $%,p}3B+# }  D}  F} $*,p| $% } ~ $%,p}3B+# }  D}  F} } ~ $$,pz B}  D}   ~ $$,p{ B}  D} $#  ~ $#,p}3B+# }  D}  F} 
9 B~ ~,kk ~3B+#  
9 $.,kh $-,kj B~2@	+#66$ 1V+#&  $-,kh  B~ x B}  B} $#  ~ $#,p}3B+#/ }  D}  F} $*,p| } ~ $",pz B}  D} 
9 B~ ~,kk ~3B+#8 
9 $.,kh $-,kj B~2@	+#_6$ 1V+#>  $-,kh  B~ x B}  B} $"  ~ $",p}3B+#G }  D}  F} } } ~ $(,p{ B}  D} $*,p| $( } ~ $(,p}3B+#R }  D}  F} $*,p| } ~ $-,p|3B+#X }  D}  F} } } ~ $',p{ B}  D} 
9 B~ ~,kk ~3B+#a 
9 $.,kh $-,kj B~2@	+$6$ 1V+#g  $-,kh  B~ x B}  B} $"  ~ $",p}3B+#p }  D}  F} } } ~ $(,p{ B}  D} $*,p| } ~ $-,p|3B+#z }  D}  F} } } ~ $(,p{ B}    ~ $&,p{ B}    ~ $!,p{ B}  
9 B~ ~,kk ~3B+$
 
9 $.,kh $-,kj B~2@	+$6$ 1V+$  $-,kh  B~ x B}  $!  ~ $!,p}3B+$ }   
9 B~ ~,kk ~3B+$ 
9 $.,kh 
 L  B~ ,kk ~>|,~<x
 l
 n
 o
 p
 q
 s
 t
 u
 v
 w
 x
 y
 z
 {
 |
 ~
 
!
!
!<	B
!
!
!<	C<<}UNITSTATUSHATYPEPROTECTIONACTENAMEIOSTATHAFILEERREDISPOSEHADIRECTORY<>
$@DIALOGHA=VICDEVICELO
$>
$A<
G<@> 
 Bx &0,kj B2@	+&% &/,kj B2@	+$U ,jG 
 B~ D~   &/,pw ~ ~ &.,pw ~ ~ &.,pw ~  B~ ,kk ~3B&-+$X  &0,kh+$Y 
x L
 &/,kj B2@	+$e ,jG 
 B~ D~   &-,pw ~ ~ &,,pv ~  B~ ,kk ~ B3B&-+$h  &0,kh+$i 
x L
 &/,kj B2@	+$w ,jG 
 B~ D~   &,,pw ~ ~ &.,pw ~ ~ &.,pw ~  B~ ,kk ~ B3B&-+${  &0,kh+$| 
x L
 &/,kj B2@	+%
 ,jG 
 B~ D~,+ &+,pw ~ ~ &.,pw ~ ~ &.,pw ~  B~ ,kk ~ B3B&-+%
x L
 &/,kj B2@	+% ,jG 
 B~ D~   &+,pw ~ ~ &.,pw ~ ~ &*,pw ~  B~ ,kk ~ B3B&-+%   &0,kh+%! 
x L
 &/,kj B2@	+%/ ,jG 
 B~ D~   &*,pw ~ ~ &.,pw ~ ~ &.,pw ~  B~ ,kk ~ B3B&-+%2  &0,kh+%3 
x L
 &/,kj B2@	+%A ,jG 
 B~ D~   &),pw ~ ~ &.,pw ~ ~ &),pw ~  B~ ,kk ~ B3B&-+%E  &0,kh+%F 
x L
 &/,kj B2@	+%T ,jG 
 B~ D~   &(,pw ~ ~ &.,pw ~ ~ &.,pw ~  B~ ,kk ~ B3B&-+%W  &0,kh+%X 
x L
 &/,kj B2@	+%f ,jG 
 B~ D~   &(,pw ~ ~ &.,pw ~ ~ &),pw ~  B~ ,kk ~ B3B&-+%j  &0,kh+%k 
x L
 &/,kj B2@	+%y ,jG 
 B~ D~   &',pw ~ ~ &.,pw ~ ~ &.,pw ~  B~ ,kk ~ B3B&-+%|  &0,kh+%} 
x L
 &/,kj B2@	+& ,jG 
 B~ D~   &',pw ~ ~ &.,pw ~ ~ &.,pw ~  B~ ,kk ~ B3B&-+&  &0,kh+& 
x L
 &/,kj B2@	+& ,jG 
 B~ D~   &&,pw ~ ~ &.,pw ~ ~ &),pw ~  B~ ,kk ~3B&-+&!  &0,kh+&" 
x L
 
x L
 &- B ,kk >},~
$.
$/
$1
$2
$4<	C
$5
$6<

$7
$8
$:
$;
$<<~<
G
$>
$?<<}UNITSTATUSHATYPEPROTECTIONACTENAMEIOSTATHAFILEERREDISPOSEHADIRECTORY<>
&BDIALOGHA=VICDEVICELO
&@
&C<
G<@> Bx  B )B,kj B2@	+)8 )B,kj B~2@	+&e6)91V+&O  )B,kh  B~ x B}  B} )A  ~ )A,p}3B+&X }  D}  F} )A } ~ )A,p}3B+&^ }  D}  F} } ~ )@,p|3B+&c }  D}  
9 B~ ~,kk ~3B+&h 
9 )B,kh )B,kj B~2@	+&}6)91V+&m  )B,kh  B~ x B}  B} )@  ~ )@,p}3B+&v }  D}  F} } } ~ )?,p{ B}  D} 
9 B~ ~,kk ~3B+& 
9 )B,kh )B,kj B~2@	+'6)91V+'  )B,kh  B~ x B}  B} )?  ~ )?,p}3B+' }  D}  F} )A } ~ )A,p}3B+' }  D}  F} } ~ )@,p|3B+' }  D}  F} 
9 B~ ~,kk ~3B+' 
9 )B,kh )B,kj B~2@	+';6)91V+'$  )B,kh  B~ x B}  B} )>  ~ )>,p}3B+'- }  D}  F} )A } ~ )A,p}3B+'3 }  D}  F} } ~ )@,p|3B+'8 }  D}  F} 
9 B~ ~,kk ~3B+'= 
9 )B,kh )B,kj B~2@	+'Z6)91V+'C  )B,kh  B~ x B}  B} )>  ~ )>,p}3B+'L }  D}  F} )A } ~ )A,p}3B+'R }  D}  F} } ~ )=,p|3B+'W }  D}  F} 
9 B~ ~,kk ~3B+'\ 
9 )B,kh )B,kj B~2@	+'y6)91V+'b  )B,kh  B~ x B}  B} )=  ~ )=,p}3B+'k }  D}  F} )A } ~ )A,p}3B+'q }  D}  F} } ~ )@,p|3B+'v }  D}  F} 
9 B~ ~,kk ~3B+'{ 
9 )B,kh )B,kj B~2@	+(6)91V+(  )B,kh  B~ x B}  B} )<  ~ )<,p}3B+(
 }  D}  F} )A } ~ )A,p}3B+( }  D}  F} } ~ )<,p|3B+( }  D}  F} 
9 B~ ~,kk ~3B+( 
9 )B,kh )B,kj B~2@	+(76)91V+(   )B,kh  B~ x B}  B} );  ~ );,p}3B+() }  D}  F} )A } ~ )A,p}3B+(/ }  D}  F} } ~ )@,p|3B+(4 }  D}  F} 
9 B~ ~,kk ~3B+(9 
9 )B,kh )B,kj B~2@	+(V6)91V+(?  )B,kh  B~ x B}  B} );  ~ );,p}3B+(H }  D}  F} )A } ~ )A,p}3B+(N }  D}  F} } ~ )<,p|3B+(S }  D}  F} 
9 B~ ~,kk ~3B+(X 
9 )B,kh )B,kj B~2@	+(u6)91V+(^  )B,kh  B~ x B}  B} ):  ~ ):,p}3B+(g }  D}  F} )A } ~ )A,p}3B+(m }  D}  F} } ~ )@,p|3B+(r }  D}  F} 
9 B~ ~,kk ~3B+(w 
9 )B,kh )B,kj B~2@	+)6)91V+(}  )B,kh  B~ x B}  B} ):  ~ ):,p}3B+) }  D}  F} )A } ~ )A,p}3B+)
 }  D}  F} } ~ )@,p|3B+) }  D}  F} 
9 B~ ~,kk ~3B+) 
9 )B,kh )B,kj B~2@	+)26)91V+)  )B,kh  B~ x B}  B} )9  ~ )9,p}3B+)% }  D}  F} )A } ~ )A,p}3B+)+ }  D}  F} } ~ )<,p|3B+)/ }   
9 B~ ~,kk ~3B+)4 
9 )B,kh 
 L  B~ ,kk ~>|,~<x
&0
&1
&3
&4
&6<	C
&7
&8<

&9
&:
&<
&=
&><
G
&@
&A<<}<>
)D
)E<@<=
)F
)G
)H,PEA
)I
)J<
)K<
h<@
)L<@ RMA> 
 Bx )h,kj B2@	+)e )g,kj B2@	+)] ,jG 
 B~ D~   )g,pw ~ ~ )f,pv ~  B~ ,kk ~3B)f+)`  )h,kh+)a 
x L
 
x L
 )f B ,kk >},~<~
)C<
h<<}<>
)i
)j<@<=
)k
)l
)m,PEA
)n
)o<
)p<
h<@
)q<@ RMA> Bx  B *,kj B2@	+* *,kj B~2@	+*6*1V+)}  *,kh  B~ x B}  B}  ~ *,p|3B+* }  D}  F} } } ~ *,p{  
9B~ ~,kk ~3B+*
9 *,kh 
 L  B~ ,kk ~>|,~<x
)h<
h<<}&TTE$INT*TTE> 
 Bx *c,kj B2@	+*^ *b,kj B2@	+*( ,jG 
 B~ D~   *b,pw ~ ~ *a,pw ~  B~ ,kk ~3B*a+*+  *c,kh+*, 
x L
 *b,kj B2@	+*8 ,jG 
 B~ D~   *`,pw ~ ~ *a,pw ~  B~ ,kk ~ B3B*a+*;  *c,kh+*< 
x L
 *b,kj B2@	+*H ,jG 
 B~ D~   *`,pw ~ ~ *a,pw ~  B~ ,kk ~ B3B*a+*L  *c,kh+*M 
x L
 *b,kj B2@	+*W ,jG 
 B~ D~   *_,pw ~  B~ ,kk ~3B*a+*Z  *c,kh+*[ 
x L
 
x L
 *a B ,kk >},~<	B
*
*<~<

*<<}&TTE$INT*TTE> Bx  B +O,kj B2@	++J +N,kj B~2@	++6+K1V+*q  +N,kh  B~ x B}  B} +N  ~ +N,p}3B+*z }  D}  F} } ~ +M,p|3B+* }  D}  
9 B~ ~,kk ~3B++ 
9 +O,kh +N,kj B~2@	++6+K1V++	  +N,kh  B~ x B}  B} +N  ~ +M,p}3B++ }  D}  F} } ~ +M,p|3B++ }  D}  F} 
9 B~ ~,kk ~3B++ 
9 +O,kh +N,kj B~2@	++36+K1V++"  +N,kh  B~ x B}  B} +L  ~ +L,p}3B+++ }  D}  F} } ~ +M,p|3B++0 }  D}  
9 B~ ~,kk ~3B++5 
9 +O,kh +N,kj B~2@	++D6+K1V++;  +N,kh  B~ x B}   ~ +L,p|3B++B }   
9 B~ ~,kk ~3B++G 
9 +O,kh 
 L  B~ ,kk ~>|,~<x<	B
*c
*d<

*e<<}<{<@<<@<|<@D20FOR$DATA-CLISTRED20FOR$DATA-NLISTRED20FOR$LAST-UPPER-BOUND-PRINTD20FOR$ID-OR-INT-EX
D20FOR$ID-OR-INT-PRINTD20FOR$DATA-DLISTSTD20FOR$DATA-NLIST-PRINT
D20FOR$DATA-DLIST-ELEMENTON D20FOR$DATA-DLIST-ELEMENT-PRINTD20FOR$DATA-DLIST-PRINTD20FOR$DATA-CLIST-PRINT<>
,<>
,PRECISION<>
,FUNCTIONP<>
,<>
,DOUBLERI<>
,<>
,WHILE*NT<>
,DOTE<>
,<>
,<>
,DIMENSION<>
, )0FO<>
,!,0FO(RMADECODEAT<>
,"<>
,#/0FO<>
,$DATA=0FO<>
,%<>
,&
,'<@
,(
,)
,
,*<	D<@
,(
,+
,

,,<

,-<

,.
,/<@
,0<@<	C
,1
,(
,2
,3<@
,4<@
,5<@
,6<@
,
,7
,
,8<=
,9<
,:
,
,;
,<
,=
+u<@<	C<@
,><@
,>
,?<=
,@<=
,A
,B<@<
*<@<=
,C<=
,D<=
,E<=
,F
,G
,H<	B
,I
,

,J
,K<@
,
,L<>
,M
,<@<>
,N
,(<@
,

,O
,

,P:0FO
,

,Q
,

,R
,

,S
,

,T<>
,,
,B
,U
,V
,=
,(
,W RMA<
f
,X<	F<@
,
<@
,(
,Y
,(
,Z
,(
,[
,(
,\<
i<@<
j<@
,G
,=<>
,]<	C
,^
,
,=<	C
,
,
,_
,`<@<
j
,a
,b<@
+y
,c<
f<@<
,d
,
,e<=
,f
+t<@<
(
,g
,
,h
,

,i<
)<@<
i
,j<	B<@
,
,k
,<@> 
 Bx .q,kj B2@	+.\ .p,kj B2@	+- ,jG 
 B~ D~   .p,pw ~ ~ .o,pv ~ ~ .o,pv ~ ~ .n,pw ~ ~ .n,pw ~  B~ ,kk ~ B3B.m+-,pk3B+-   .q,kh+-	 
x L
 .p,kj B2@	+-! ,jG 
 B~ D~   .m,pw ~ ~ .l,pw ~ ~ .l,pv ~ ~ .k,pw ~ ~ .k,pw ~ ~ .j,pv ~ ~ .k,pw ~ ~ .j,pv ~  B~ ,kk ~ B3B.m+-',pk3B+-'   .q,kh+-( 
x L
 .p,kj B2@	+-D ,jG 
 B~ D~   .i,pw ~ ~ .i,pw ~ ~ .h,pw ~ ~ .h,pw ~ ~ .n,pw ~ ~ .h,pw ~ ~ .p,pw ~ ~ .g,pv ~ ~ .g,pw ~ ~ .f,pv ~  B~ ,kk ~ B3B.m+-I,pk3B+-I   .q,kh+-J 
x L
 .p,kj B2@	+-b ,jG 
 B~ D~   .f,pw ~ ~ .p,pw ~ ~ .i,pw ~ ~ .e,pv ~ ~ .e,pw ~ ~ .d,pv ~ ~ .g,pw ~ ~ .d,pv ~  B~ ,kk ~ B3B.m+-h,pk3B+-h   .q,kh+-i 
x L
 .p,kj B2@	+-} ,jG 
 B~ D~   .c,pw ~ ~ .c,pv ~ ~ .b,pw ~ ~ .i,pw ~ ~ .n,pw ~ ~ .g,pw ~  B~ ,kk ~ B3B.m+.,pk3B+.   .q,kh+. 
x L
 .p,kj B2@	+. ,jG 
 B~ D~   .c,pw ~ ~ .b,pv ~ ~ .p,pw ~ ~ .n,pw ~ ~ .h,pw ~ ~ .h,pw ~ ~ .h,pw ~ ~ .a,pv ~  B~ ,kk ~ B3B.m+.!,pk3B+.!   .q,kh+." 
x L
 .p,kj B2@	+.6 ,jG 
 B~ D~   .a,pw ~ ~ .`,pv ~ ~ .`,pv ~ ~ ._,pw ~ ~ .p,pw ~ ~ ._,pv ~  B~ ,kk ~ B3B.m+.;,pk3B+.;   .q,kh+.< 
x L
 .p,kj B2@	+.R ,jG 
 B~ D~   .a,pw ~ ~ .^,pw ~ ~ .`,pv ~ ~ .p,pw ~ ~ .`,pv ~ ~ .^,pv ~ ~ .],pv ~  B~ ,kk ~ B3B.m+.X,pk3B+.X   .q,kh+.Y 
x L
 
x L
 .m B ,kk >},~
+s
+t
+u
+w
+x
+y
+z
+{
+}
+~
+
,
,
,
,<
f
,
,
,
,
,	
,
<	C
,
,

,
,<
i
,
,<
j
,<~<	B
,
,
,<	C<<}<>
/<>
/PRECISION<>
/FUNCTIONP<>
/<>
/DOUBLERI<>
/<>
/WHILE*NT<>
/DOTE<>
/<>
/<>
/DIMENSION<>
/)0FO<>
/ ,0FO(RMADECODEAT<>
/!<>
/"/0FO<>
/# RMADATA=0FO<>
/$<>
/%
/&<@
/'
/(
/	
/)<	D<@
/'
/*
/
/+<

/,<

/-
/.<@
//<@<	C
/0
/'
/1
/2<@
/3<@
/4<@
/5<@
/	
/6
/	
/7<=
/8<
/9
/	
/:
/;
/<
.s<@<	C<@
/=<@
/=
/><=
/?<=
/@
/A<@<
*<@<=
/B<=
/C<=
/D<=
/E
/F
/G<	B
/H
/
/I
/<@
/
/J<>
/K
/<@<>
/L
/'<@
/
/M
/
/N:0FO
/
/O
/
/P
/
/Q
/
/R<>
/+
/A
/S
/T
/<
/'
/U<
f
/V<	F<@
/<@
/'
/W
/'
/X
/'
/Y
/'
/Z<
i<@<
j<@
/F
/<<>
/[<	C
/\
/
/<<	C
/
/
/]
/^<@<
j
/_
/`<@
.w
/a<
f<@<
/b
/
/c<=
/d
.r<@<
(
/e
/
/f
/
/g<
)<@<
i
/h<	B<@
/

/i
/@> Bx  B 3-,kj B2@	+3 3,,kj B~2@	+0631V+/u  3,,kh  B~ x B}  B}  ~ 3,,p|3B+/} }  D}  F} } } ~ 3+,p{ B}  D}   ~ 3+,p{ B}  D} 3*  ~ 3*,p}3B+0 }  D}  F} } ~ 3*,p|3B+0 }  D}  
9 B~ ~,kk ~3B+0 
9 3-,kh 3,,kj B~2@	+0J631V+0  3,,kh  B~ x B}  B} 3)  ~ 3),p}3B+0$ }  D}  F} 3),p| } ~ 3(,p|3B+0* }  D}  F} } } ~ 3(,p{ B}  D} 3'  ~ 3',p}3B+04 }  D}  F} } ~ 3',p|3B+0: }  D}  F} } } ~ 3&,p{ B}  D} 3'  ~ 3',p}3B+0D }  D}  F} } } ~ 3&,p{ B}  D} 
9 B~ ~,kk ~3B+0M 
9 3-,kh 3,,kj B~2@	+1631V+0R  3,,kh  B~ x B}  B} 3%  ~ 3%,p}3B+0[ }  D}  F} 3),p| 3% } ~ 3%,p}3B+0b }  D}  F} } ~ 3$,p|3B+0h }  D}  F} 3$ } ~ 3$,p}3B+0n }  D}  F} 3),p| } ~ 3*,p|3B+0t }  D}  F} 3$ } ~ 3$,p}3B+0z }  D}  F} 3),p| } ~ 3,,p|3B+1 }  D}  F} } } ~ 3#,p{ B}  D} 3#  ~ 3#,p}3B+1 }  D}  F} } } ~ 3",p{ B}  D} 
9 B~ ~,kk ~3B+1 
9 3-,kh 3,,kj B~2@	+1J631V+1  3,,kh  B~ x B}  B} 3"  ~ 3",p}3B+1" }  D}  F} 3),p| } ~ 3,,p|3B+1) }  D}  F} 3),p| 3% } ~ 3%,p}3B+10 }  D}  F} } } ~ 3!,p{ B}  D}  ~ 3!,p|3B+19 }  D}  F} } } ~ 3 ,p{ B}  D} 3#  ~ 3#,p}3B+1C }  D}  F} } } ~ 3 ,p{ B}  D} 
9 B~ ~,kk ~3B+1L 
9 3-,kh 3,,kj B~2@	+1{631V+1R  3,,kh  B~ x B}  B} 3  ~ 3,p}3B+1[ }  D}  F} 3),p| } } ~ 3,p{ B}  D} 3  ~ 3,p}3B+1f }  D}  F} 3),p| 3% } ~ 3%,p}3B+1m }  D}  F} } ~ 3*,p|3B+1r }  D}  F} 3# } ~ 3#,p}3B+1x }  D}  F} 
9 B~ ~,kk ~3B+1} 
9 3-,kh 3,,kj B~2@	+27631V+2  3,,kh  B~ x B}  B} 3  ~ 3,p}3B+2
 }  D}  F} 3),p| } } ~ 3,p{ B}  D} 3),p| } ~ 3,,p|3B+2 }  D}  F} 3),p| 3* } ~ 3*,p}3B+2 }  D}  F} 3),p| } ~ 3$,p|3B+2% }  D}  F} 3$ } ~ 3$,p}3B+2+ }  D}  F} } ~ 3$,p|3B+20 }  D}  F} } } ~ 3,p{ B}  D} 
9 B~ ~,kk ~3B+29 
9 3-,kh 3,,kj B~2@	+2d631V+2?  3,,kh  B~ x B}  B} 3  ~ 3,p}3B+2H }  D}  F} } } ~ 3,p{ B}  D}   ~ 3,p{ B}  D} 3),p| 3 } ~ 3,p}3B+2W }  D}  F} 3),p| } ~ 3,,p|3B+2] }  D}  F} } } ~ 3,p{ B}  D} 
9 B~ ~,kk ~3B+2f 
9 3-,kh 3,,kj B~2@	+3631V+2l  3,,kh  B~ x B}  B} 3  ~ 3,p}3B+2u }  D}  F} 3),p| 3 } ~ 3,p}3B+2| }  D}  F} } } ~ 3,p{ B}  D} 3),p| } ~ 3,,p|3B+3 }  D}  F} } } ~ 3,p{    ~ 3,p{    ~ 3,p{  
9 B~ ~,kk ~3B+3 
9 3-,kh 
 L  B~ ,kk ~>|,~<x
.q
.r
.s
.u
.v
.w
.x
.y
.{
.|
.}
.~
.
/
/<
f
/
/
/
/
/
/<	C
/	
/

/
/
<
i
/
/<
j
/
/<	B
/
/
/<	C<<}*TTE> 
 Bx 3U,kj B2@	+3R 3U,kj B2@	+3= ,jG 
 B~ D~   3T,pw ~  B~ ,kk ~3B3T+3@  3U,kh+3A 
x L
 3U,kj B2@	+3K ,jG 
 B~ D~   3S,pw ~  B~ ,kk ~3B3T+3N  3U,kh+3O 
x L
 
x L
 3T B ,kk >},~<	C<~
3-<<}*TTE> Bx  B 4,kj B2@	+4 4,kj B~2@	+3l641V+3a  4,kh  B~ x B}  4  ~ 4,p}3B+3i }  D}  
9 B~ ~,kk ~3B+3n 
9 4,kh 4,kj B~2@	+3}641V+3t  4,kh  B~ x B}   ~ 4,p|3B+3{ }   
9 B~ ~,kk ~3B+4 
9 4,kh 
 L  B~ ,kk ~>},~<x<	C
3V<<}> 
 Bx 4.,kj B2@	+4+ 4-,kj B2@	+4 ,jG 
 B~ D~   4-,pw ~  B~ ,kk ~3B4,+4  4.,kh+4 
x L
 4-,kj B2@	+4# ,jG 
 B~ D~   4,,pw ~  B~ ,kk ~3B4,+4&  4.,kh+4' 
x L
 
x L
 4, B ,kk >},~<	C<~<
<<}> Bx  B 4],kj B2@	+4Z 4],kj B~2@	+4C64[1V+49  4],kh  B~ x B}   ~ 4\,p|3B+4@ }  D}  
9 B~ ~,kk ~3B+4E 
9 4],kh 4],kj B~2@	+4T64[1V+4K  4],kh  B~ x B}   ~ 4\,p|3B+4R }   
9 B~ ~,kk ~3B+4W 
9 4],kh 
 L  B~ ,kk ~>},~<x<	C<
<<})0FO<>
4f=0FO,0FO(TTE<>
4g<>
4h<>
4i
4a
4j
4k<@
4b
4l
4b
4m<	C<@<=
4n
4o
4p<
k
4q
4a
4r<>
4s
4t
4u
4v
4w
4x
4y<
k<@:0FO
4o
4w<>
4z
4^<@<
4{<	C
4|
4}<@
4~<@
4e
4<=
5 RMA
4d<@
4a
4s> 
 Bx 5D,kj B2@	+5= 5D,kj B2@	+5 ,jG 
 B~ D~   5C,pw ~ ~ 5C,pv ~ ~ 5B,pv ~ ~ 5B,pv ~  B~ ,kk ~3B5A+5  5D,kh+5 
x L
 5D,kj B2@	+55 ,jG 
 B~ D~   5A,pw ~ ~ 5@,pw ~ ~ 5@,pw ~ ~ 5C,pw ~ ~ 5?,pw ~ ~ 5?,pw ~ ~ 5@,pw ~ ~ 5?,pw ~ ~ 5>,pv ~ ~ 5>,pw ~  B~ ,kk ~3B5A+58  5D,kh+59 
x L
 
x L
 5A B ,kk >},~
4^
4_<	C
4`
4a<
l
4b<~
4c
4d
4e<	C<<})0FO<>
5M=0FO,0FO(TTE<>
5N<>
5O<>
5P
5H
5Q
5R<@
5I
5S
5I
5T<	C<@<=
5U
5V
5W<
k
5X
5H
5Y<>
5Z
5[
5\
5]
5^
5_
5`<
k<@:0FO
5V
5^<>
5a
5E<@<
5b<	C
5c
5d<@
5e<@
5L
5f<=
5g RMA
5K<@
5H
5Z> Bx  B 6Z,kj B2@	+6S 6Z,kj B~2@	+6	66T1V+5r  6Z,kh  B~ x B}  B}  ~ 6Y,p|3B+5{ }  D}  F} } } ~ 6Y,p{ B}  D}   ~ 6X,p{ B}  D}   ~ 6X,p{ B}  
9 B~ ~,kk ~3B+6 
9 6Z,kh 6Z,kj B~2@	+6M66T1V+6  6Z,kh  B~ x B}  B} 6W  ~ 6W,p}3B+6 }  D}  F} } ~ 6W,p|3B+6 }  D}  F} 6V } ~ 6V,p}3B+6% }  D}  F} } ~ 6Y,p|3B+6+ }  D}  F} 6V } ~ 6V,p}3B+61 }  D}  F} } ~ 6U,p|3B+66 }  D}  F} 6V } ~ 6V,p}3B+6< }  D}  F} } ~ 6U,p|3B+6B }  D}  F} } } ~ 6U,p{ B}  6T  ~ 6T,p}3B+6J }   
9 B~ ~,kk ~3B+6O 
9 6Z,kh 
 L  B~ ,kk ~>|,~<x
5E
5F<	C
5G
5H<
l
5I
5J
5K
5L<	C<<}<>
6e=0FO,0FO<>
6f:0FO<>
6g<>
6h)0FO<>
6i(0FO
6]
6j<
k
6k<
k<@
6d
6l
6m<@<	C<@
6b<@
6`
6n<=
6o
6_
6p
6]
6g
6`
6k> 
 Bx 7P,kj B2@	+7G 7P,kj B2@	+7	 ,jG 
 B~ D~   7O,pw ~ ~ 7O,pw ~ ~ 7N,pw ~ ~ 7N,pv ~ ~ 7M,pw ~ ~ 7M,pv ~  B~ ,kk ~3B7L+7
  7P,kh+7
x L
 7P,kj B2@	+7 ,jG 
 B~ D~   7O,pw ~ ~ 7O,pw ~ ~ 7L,pv ~ ~ 7K,pw ~ ~ 7K,pv ~  B~ ,kk ~ B3B7L+7#  7P,kh+7$ 
x L
 7P,kj B2@	+7@ ,jG 
 B~ D~   7O,pw ~ ~ 7J,pw ~ ~ 7J,pw ~ ~ 7O,pw ~ ~ 7I,pw ~ ~ 7I,pw ~ ~ 7J,pw ~ ~ 7I,pw ~ ~ 7H,pv ~ ~ 7M,pw ~  B~ ,kk ~3B7L+7C  7P,kh+7D 
x L
 
x L
 7L B ,kk >},~
6[<	C
6\
6]<
l
6^
6_
6`<~
6a
6b
6c<
k
6d<	C<<}<>
7[=0FO,0FO<>
7\:0FO<>
7]<>
7^)0FO<>
7_(0FO
7S
7`<
k
7a<
k<@
7Z
7b
7c<@<	C<@
7X<@
7V
7d<=
7e
7U
7f
7S
7]
7V
7a>BxB9,kjB2@	+99,kj B~2@	+8691V+7q  9,kh  B~ x B}  B}  ~ 9,p|3B+7z }  D}  F} 9 } ~ 9,p}3B+8 }  D}  F} } ~ 9
  ~ 9
,p}3B+8 }  D}  F} } } ~ 9
,p{ B}  
9 B~ ~,kk ~3B+8 
9 9,kh 9,kj B~2@	+8<691V+8  9,kh  B~ x B}  B}  ~ 9,p|3B+8& }  D}  F} 9 } ~ 9,p}3B+8, }  D}  F} } } ~ 9,p{ B}  D} 9  ~ 9,p}3B+86 }  D}  F} } } ~ 9
,p{ B}  D} 
9 B~ ~,kk ~3B+8? 
9 9,kh 9,kj B~2@	+9691V+8D  9,kh  B~ x B}  B} 9  ~ 9,p}3B+8M }  D}  F} } ~ 9
,p|3B+8S }  D}  F} 9	 } ~ 9	,p}3B+8Y }  D}  F} } ~ 9,p|3B+8^ }  D}  F} 9	 } ~ 9	,p}3B+8d }  D}  F} } ~ 9,p|3B+8j }  D}  F} 9	 } ~ 9	,p}3B+8p }  D}  F} } ~ 9,p|3B+8u }  D}  F} } } ~ 9,p{ B}  9
  ~ 9
,p}3B+8~ }   
9 B~ ~,kk ~3B+9 
9 9,kh 
 L  B~ ,kk ~>|,~<x
7Q<	C
7R
7S<
l
7T
7U
7V
7W
7X
7Y<
k
7Z<	C<<}<>
9
9<@<=
9
9
9,PEA<
m<@> 
 Bx 91,kj B2@	+9. 90,kj B2@	+9& ,jG 
 B~ D~   90,pw ~ ~ 9/,pv ~  B~ ,kk ~3B9/+9)  91,kh+9* 
x L
 
x L
 9/ B ,kk >},~<~
9<
m<<}<>
92
93<@<=
94
95
96,PEA<
m<@> Bx  B 9Y,kj B2@	+9V 9X,kj B~2@	+9P69W1V+9B  9X,kh  B~ x B}  B}  ~ 9X,p|3B+9J }  D}  F} } } ~ 9W,p{  
9 B~ ~,kk ~3B+9R 
9 9Y,kh 
 L  B~ ,kk ~>|,~<x
91<
m<<}.FALSE.NT.TRUE.INT)0FO,0FO(0FO<>
9a<>
9b
9c<@<

9d<
9e
9f<@
9g
9h*0FO+LEC
9i<@-LEC> 
 Bx ;,kj B2@	+; ;,kj B2@	+9{ ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~  B~ ,kk ~3B;+9~  ;,kh+9 
x L
 ;,kj B2@	+: ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~  B~ ,kk ~ B3B;+:  ;,kh+: 
x L
 ;,kj B2@	+: ,jG 
 B~ D~   ;,pv ~ ~ ;,pv ~ ~ ;,pw ~  B~ ,kk ~ B3B;+:!  ;,kh+:" 
x L
 ;,kj B2@	+:. ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~  B~ ,kk ~ B3B;+:1  ;,kh+:2 
x L
 ;,kj B2@	+:> ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~  B~ ,kk ~ B3B;+:B  ;,kh+:C 
x L
 ;,kj B2@	+:W ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~ ~ ;,pw ~ ~ ;,pw ~ ~ ;,pw ~ ~ ;,pw ~  B~ ,kk ~ B3B;+:Z  ;,kh+:[ 
x L
 ;,kj B2@	+:g ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~  B~ ,kk ~ B3B;+:k  ;,kh+:l 
x L
 ;,kj B2@	+:x ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~  B~ ,kk ~ B3B;+:{  ;,kh+:| 
x L
 ;,kj B2@	+; ,jG 
 B~ D~   ;,pv ~ ~ ;,pw ~  B~ ,kk ~3B;+;  ;,kh+;
 
x L
 
x L
 ; B ,kk >},~<

9Y
9[
9\
9]<	C
9^<
<
<

9_<
<~<

9`<<}.FALSE.NT.TRUE.INT)0FO,0FO(0FO<>
;!<>
;"
;#<@<

;$<
;%
;&<@
;'
;(*0FO+LEC
;)<@-LEC> Bx  B =!,kj B2@	+= =!,kj B~2@	+;C6=1V+;5  =!,kh  B~ x B}  B} }  ~ = ,p{ B}  D}  ~ = ,p|3B+;A }  D}  
9 B~ ~,kk ~3B+;F 
9 =!,kh =!,kj B~2@	+;Z6=1V+;K  =!,kh  B~ x B}  B} }  ~ = ,p{ B}  D}  ~ =,p|3B+;X }  D}  F} 
9 B~ ~,kk ~3B+;] 
9 =!,kh =!,kj B~2@	+;u6=1V+;b  =!,kh  B~ x B}  B} }  ~ = ,p{ B}  D}   ~ =,p{ B}  D}  ~ =,p|3B+;s }  D}  F} 
9 B~ ~,kk ~3B+;x 
9 =!,kh =!,kj B~2@	+<
6=1V+;}  =!,kh  B~ x B}  B} }  ~ = ,p{ B}  D}  ~ =,p|3B+<
 }  D}  F} 
9 B~ ~,kk ~3B+< 
9 =!,kh =!,kj B~2@	+<#6=1V+<  =!,kh  B~ x B}  B} }  ~ = ,p{ B}  D}  ~ =,p|3B+<! }  D}  F} 
9 B~ ~,kk ~3B+<& 
9 =!,kh =!,kj B~2@	+<Q6=1V+<+  =!,kh  B~ x B}  B} }  ~ = ,p{ B}  D} =  ~ =,p}3B+<8 }  D}  F} } ~ =,p|3B+<> }  D}  F} = } ~ =,p}3B+<D }  D}  F} } ~ =,p|3B+<I }  D}  F} = } ~ =,p}3B+<O }  D}  
9 B~ ~,kk ~3B+<T 
9 =!,kh =!,kj B~2@	+<g6=1V+<Y  =!,kh  B~ x B}  }  ~ = ,p{ B}  =  ~ =,p}3B+<e }  D}  
9 B~ ~,kk ~3B+<j 
9 =!,kh =!,kj B~2@	+<}6=1V+<o  =!,kh  B~ x B}  }  ~ = ,p{ B}  =  ~ =,p}3B+<{ }  D}  
9 B~ ~,kk ~3B+= 
9 =!,kh =!,kj B~2@	+=6=1V+=  =!,kh  B~ x B}  }  ~ = ,p{ B}   ~ =,p|3B+= }   
9 B~ ~,kk ~3B+= 
9 =!,kh 
 L  B~ ,kk ~>|,~<x<

;
;
;
;<	C
;<
<
<

;<
<

; <<}<{<@<<@<|<@
D20FOR$SUBROUTINE-LISTSS	D20FOR$FUNNY-ID-LISTRESSD20FOR$FUNNY-IDLIST
D20FOR$FUNNY-ID-LIST-PRINT
D20FOR$FUNNY-ID-PRINTEXTERNALI<=
=MEQUIVALENCEUTI<>
=NENTRYNRI<>
=O<
=PENDFILEO-DOMAIFMAENDE<>
=Q)0FO<>
=R,0FO(RMAENCODEEN<>
=SELSE=0FO<>
=T<>
=U
=V
=W
=E
=X
=Y<@<
(
=Z
=[
=\
=]<@
=[
=^
=E
=_
=E
=`<>
=a
=E
=b
=c
=d<=
=e<
)
=f<
=g<
*<@<=
=h
=?
=i
=j
=k<	B
=l
=D<@<	C
=m<>
=n
=B<@
=D
=o<
"<@
=p<@
=D
=q
=[
=r<>
=s
=t
=u
=v
=d
=w
=x<
o<@
=[
=y RMA
=[
=z
=E
={<	C<@:0FO
=j
=d<>
=|<>
=}
=K
=~
=<@
><@<	B
>
><@
=[
>
>
=d<
><
>
=B
><=
>
=E
>	<>
>
<
(
><
(
>

=[
>
=D
>
>
>
><@<
)
><
)<@
><@<	B<@<>
><	C
><=
><
!<@THEN<	C
>
>
=d
=D
>
=t<@<>
>
=[
>
><@<	C
><=
>
=w
>
=D
> 
=K<@
=[
>!
>
=s> 
 Bx @ ,kj B2@	+@ @ ,kj B2@	+>8 ,jG 
 B~ D~   @,pw ~ ~ @,pv ~ ~ @,pv ~ ~ @,pw ~ ~ @,pw ~  B~ ,kk ~ B3B@+>>,pk3B+>>   @ ,kh+>? 
x L
 @ ,kj B2@	+>K ,jG 
 B~ D~   @,pw ~ ~ @,pv ~  B~ ,kk ~ B3B@+>P,pk3B+>P   @ ,kh+>Q 
x L
 @ ,kj B2@	+>m ,jG 
 B~ D~   @,pw ~ ~ @,pw ~ ~ @,pw ~ ~ @,pw ~ ~ @,pw ~ ~ @,pw ~ ~ @,pw ~ ~ @,pv ~ ~ @,pw ~ ~ @,pv ~  B~ ,kk ~ B3B@+>s,pk3B+>s   @ ,kh+>t 
x L
 @ ,kj B2@	+? ,jG 
 B~ D~   @,pw ~ ~ @,pw ~  B~ ,kk ~ B3B@+?,pk3B+?   @ ,kh+? 
x L
 @ ,kj B2@	+? ,jG 
 B~ D~   @,pw ~ ~ @,pw ~  B~ ,kk ~ B3B@+?,pk3B+?   @ ,kh+? 
x L
 @ ,kj B2@	+?# ,jG 
 B~ D~   @,pw ~  B~ ,kk ~ B3B@+?(,pk3B+?(   @ ,kh+?) 
x L
 @ ,kj B2@	+?; ,jG 
 B~ D~   @,pw ~ ~ @,pw ~ ~ @,pt ~ ~ @,pv ~ ~ @,pw ~  B~ ,kk ~ B3B@+?A,pk3B+?A   @ ,kh+?B 
x L
 @ ,kj B2@	+?N ,jG 
 B~ D~   @,pw ~ ~ @,pw ~  B~ ,kk ~ B3B@+?S,pk3B+?S   @ ,kh+?T 
x L
 @ ,kj B2@	+?b ,jG 
 B~ D~   @,pw ~ ~ @,pw ~ ~ @,pv ~  B~ ,kk ~ B3B@+?h,pk3B+?h   @ ,kh+?i 
x L
 @ ,kj B2@	+?u ,jG 
 B~ D~   @,pw ~ ~ @,pu ~  B~ ,kk ~ B3B@+?z,pk3B+?z   @ ,kh+?{ 
x L
 @ ,kj B2@	+@ ,jG 
,B~3D~+,+@,pw ~ ~ @,pw ~  B~ ,kk ~ B3B@+@
x L
 
x L
 @ B ,kk >},~<
o
=4
=5
=6
=8
=9
=;
=<
==
=>
=?
=@
=A
=B
=C
=D<	C
=E
=F
=H
=I<~<	B
=J
=K
=L<	C<<}EXTERNALI<=
@;EQUIVALENCEUTI<>
@<ENTRYNRI<>
@=<
(
@>ENDFILEO-DOMAIFMAENDE<>
@?)0FO<>
@@,0FO(RMA RMAENCODEEN<>
@AELSE=0FO<>
@B<>
@C
@D
@E
@2
@F
@G<@<
)
@H
@I
@J
@K<@
@I
@L
@2
@M
@2
@N<>
@O
@2
@P
@Q
@R<=
@S<
"<@<
@T<
*<@<=
@U
@,
@V
@W
@X<	B
@Y
@1<@<	C
@Z<>
@[
@/<@
@1
@\
@3<@
@1
@]
@I
@^<>
@_
@`
@a
@b
@R
@c
@d<
o<@
@I
@e
@I
@f
@2
@g<	C<@:0FO
@W
@R<>
@h<>
@i
@9
@j
@k<@
@l<@<	B
@m
@n<@
@I
@o
@p
@R<
@q<
@r
@/
@s<=
@t
@2
@u<>
@v<
(
@w<
(
@x
@I
@y
@1
@z
@{
@|
@}<@<
)
@~<
)<@
@<@<	B<@<>
A<	C
A<=
A<
!<@THEN<	C
A
A
@R
@1
A
@`<@<>
A
@I
A
A<@<	C
A	<=
A

@c
A
@1
A

@9<@
@I
A
@{
@_> Bx  B D,kj B2@	+Ct D,kj B~2@	+A66Cu1V+A  D,kh  B~ x B}  B}  ~ D,p|3B+A! }  D}  F} } } ~ D,p{ B}  D}   ~ D,p{ B}  D} D  ~ D,p}3B+A/ }  D}  F} } ~ D,p|3B+A4 }  D}  
9 B~ ~,kk ~3B+A9 
9 D,kh D,kj B~2@	+AN6Cu1V+A>  D,kh  B~ x B}  B} D  ~ D,p}3B+AG }  D}  F} } } ~ D,p{ B}  D} 
9 B~ ~,kk ~3B+AP 
9 D,kh D,kj B~2@	+B6Cu1V+AV  D,kh  B~ x B}  B} C  ~ C,p}3B+A_ }  D}  F} C,p| C~ } ~ C~,p}3B+Af }  D}  F} } ~ C~,p|3B+Ak }  D}  F} C} } ~ C},p}3B+Aq }  D}  F} C,p| } ~ D,p|3B+Ax }  D}  F} C} } ~ C},p}3B+A~ }  D}  F} C,p| } ~ D,p|3B+B }  D}  F} } } ~ C},p{ B}  D} C|  ~ C|,p}3B+B }  D}  F} } } ~ C|,p{ B}  D} 
9 B~ ~,kk ~3B+B 
9 D,kh D,kj B~2@	+B/6Cu1V+B  D,kh  B~ x B}  B} C{  ~ C{,p}3B+B& }  D}  F} C,p| C{ } ~ C{,p}3B+B- }  D}  F} 
9 B~ ~,kk ~3B+B2 
9 D,kh D,kj B~2@	+BJ6Cu1V+B7  D,kh  B~ x B}  B} C{  ~ C{,p}3B+B@ }  D}  F} C,p| Cz } ~ Cz,p}3B+BG }  D}  F} 
9 B~ ~,kk ~3B+BL 
9 D,kh D,kj B~2@	+B]6Cu1V+BR  D,kh  B~ x B}  B} C{  ~ C{,p}3B+B[ }  D}  F} 
9 B~ ~,kk ~3B+B` 
9 D,kh D,kj B~2@	+C6Cu1V+Be  D,kh  B~ x B}  B} Cz  ~ Cz,p}3B+Bn }  D}  F} C,p| C~ } ~ C~,p}3B+Bu }  D}  F} } ~ Cy,pz B}  D}   ~ Cy,p{ B}  D} C|  ~ C|,p}3B+C }  D}  F} 
9 B~ ~,kk ~3B+C 
9D,khD,kjBB~2@	+C6Cu1V+C  ~ Cz,p}3B+C }  D}  F} C,p| } ~ C~,p|3B+C }  D}  F} 
9 B~ ~,kk ~3B+C" 
9 D,kh D,kj B~2@	+C=6Cu1V+C'  D,kh  B~ x B}  B} Cx  ~ Cx,p}3B+C0 }  D}  F} C,p| } ~ D,p|3B+C7 }  D}  F} } } ~ Cx,p{ B}  D} 
9 B~ ~,kk ~3B+C@ 
9 D,kh D,kj B~2@	+CU6Cu1V+CE  D,kh  B~ x B}  B} Cw  ~ Cw,p}3B+CN }  D}  F} C,p| } ~ Cw,pz B}  D} 
9 B~ ~,kk ~3B+CX 
9 D,kh D,kj B~2@	+Cn6Cu1V+C]  D,kh  B~ x B}  B} Cv  ~ Cv,p}3B+Cf }  D}  F} C,p| } ~ Cv,p|3B+Cl }   
9 B~ ~,kk ~3B+Cq 
9 D,kh 
 L  B~ ,kk ~>|,~<x<
o
@!
@"
@#
@%
@&
@(
@)
@*
@+
@,
@-
@.
@/
@0
@1<	C
@2
@3
@4
@6
@7<	B
@8
@9
@:<	C<<}<>
D
D<@<=
D
D
D	,PEA
D

D<
D
<
p<@
D@ RMA> 
 Bx D),kj B2@	+D& D),kj B2@	+D ,jG 
 B~ D~   D(,pw ~ ~ D(,pv ~  B~ ,kk ~3BD'+D"  D),kh+D# 
x L
 
x L
 D' B ,kk >},~<~
D<
p<<}<>
D+
D,<@<=
D-
D.
D/,PEA
D0
D1<
D2<
p<@
D3<@ RMA> Bx  B DU,kj B2@	+DR DU,kj B~2@	+DL6DS1V+D>  DU,kh  B~ x B}  B}  ~ DT,p|3B+DG }  D}  F} } } ~ DT,p{  
9 B~ ~,kk ~3B+DO 
9 DU,kh 
 L  B~ ,kk ~>|,~<x
D*<
p<<}*TTE&INT> 
 Bx E,kj B2@	+E E,kj B2@	+Df ,jG 
 B~ D~   E,pw ~  B~ ,kk ~3BE+Di  E,kh+Dj 
x L
 E,kj B2@	+Dv ,jG 
 B~ D~   E,pw ~ ~ E,pw ~  B~ ,kk ~ B3BE+Dz  E,kh+D{ 
x L
 E,kj B2@	+E ,jG 
 B~ D~   E,pw ~ ~ E,pw ~  B~ ,kk ~3BE+E
  E,kh+E 
x L
 
x L
 E B ,kk >},~
DV
DW<~<	C<<}&INT*INT> Bx  B Ed,kj B2@	+E` Ec,kj B~2@	+E)6Ea1V+E  Ec,kh  B~ x B}  B}  ~ Ec,p|3B+E' }  D}  
9 B~ ~,kk ~3B+E, 
9 Ed,kh Ec,kj B~2@	+EB6Ea1V+E1  Ec,kh  B~ x B}  B} Eb  ~ Eb,p}3B+E: }  D}  F} } ~ Ec,p|3B+E@ }  D}  F} 
9 B~ ~,kk ~3B+EE 
9 Ed,kh Ec,kj B~2@	+EZ6Ea1V+EJ  Ec,kh  B~ x B}  B} Eb  ~ Eb,p}3B+ES }  D}  F} } ~ Ec,p|3B+EX }   
9 B~ ~,kk ~3B+E] 
9 Ed,kh 
 L  B~ ,kk ~>|,~<x
E
E<	C<<}<{<@<<@<|<@D20FOR$FORMAT-LISTED20FOR$FORMAT-LIST-PRINT<>
E{FUNCTIONR<>
E|FORMATEN=0FO<>
E}<>
E~<>
E<
F)0FO<>
F(RMAFIND
Ey
F
F<@
Ey
F
Ey
F
F<@<
(
F
F<@
F	
F
<=
F
F

F	B
F<=
F<
)
F<=
F<>
F
Ew<@
F
F<>
F
F
F
F
F

F
F<
#
F
F
F<	F<@<>
F<
q<@<	C<@:0FO
F

F
<>
F,PEA
F
F <
!<@
F
F!
F
F"
F#<@<
F$
Ev<@
F%<@
F<@<=
F&
F'<@<
F(
F
F) RMA<
(
F*<	B<@<
)<@> 
 Bx G4,kj B2@	+G) G3,kj B2@	+FA ,jG 
 B~ D~   G3,pw ~ ~ G2,pw ~ ~ G2,pw ~ ~ G1,pv ~ ~ G1,pw ~  B~ ,kk ~ B3BG0+FG,pk3B+FG   G4,kh+FH 
x L
 G3,kj B2@	+FZ ,jG 
 B~ D~   G3,pw ~ ~ G2,pw ~ ~ G0,pt ~ ~ G/,pv ~ ~ G1,pw ~  B~ ,kk ~ B3BG0+F_,pk3B+F_   G4,kh+F` 
x L
 G3,kj B2@	+Fr ,jG 
 B~ D~   G/,pw ~ ~ G.,pv ~ ~ G.,pv ~ ~ G-,pw ~ ~ G-,pw ~  B~ ,kk ~ B3BG0+Fx,pk3B+Fx   G4,kh+Fy 
x L
 G3,kj B2@	+G ,jG 
 B~ D~   G,,pw ~ ~ G2,pw ~ ~ G,,pw ~ ~ G+,pv ~ ~ G1,pw ~  B~ ,kk ~ B3BG0+G,pk3B+G   G4,kh+G 
x L
 G3,kj B2@	+G ,jG 
 B~ D~   G+,pw ~ ~ G/,pw ~ ~ G*,pv ~  B~ ,kk ~ B3BG0+G%,pk3B+G%   G4,kh+G& 
x L
 
x L
 G0 B ,kk >},~
Em
En
Eo<
q
Ep<	B
Er
Es
Et<	C
Eu
Ev<~
Ew
Ex<
$
Ey
Ez<<}<>
GCFUNCTIONR<>
GDFORMATEN=0FO<>
GE<>
GF<>
GG<
(
GH)0FO<>
GI(RMA RMAFIND
G@
GJ
GK<@
G@
GL
G@
GM
GN<@<
)
GO
GP<@
GQ
GR<=
GS
GT
GU<	B
GV<=
GW<
#
GX<=
GY<>
GZ
G><@
G[
G\<>
G]
G^
G_
G`
GR
Ga
Gb<
!<@
Ga
Gc<	F<@<>
Gd<
q<@<	C<@:0FO
GT
GR<>
Ge,PEA
Gf
Gg
Gf
Gh
Ga
Gi
Gj<@<
Gk
Gl<@
Gm<@
Gf<@<=
Gn
GA<@<
G=<
Go
Ga
Gp<
(
Gq<	B<@<
)<@>BxFBIE,kjB2@	+I:ID,kjDB~2@	+H6I;1V+G}ID,khDB~xB}B}IDB~ID,p}3B+H}  D}  F} IC,p| IC } ~ IC,p}3B+H
9 B~ ~,kk ~3B+H! 
9 IE,kh ID,kj B~2@	+HF6I;1V+H&  ID,kh  B~ x B}  B} ID  ~ ID,p}3B+H/ }  D}  F} IC,p| IC } ~ IC,p}3B+H6 }  D}  F} } ~ IA,pz B}  D}   ~ I@,p{ B}  D} IA  ~ IA,p}3B+HD }  D}  F} 
9 B~ ~,kk ~3B+HI 
9 IE,kh ID,kj B~2@	+Hm6I;1V+HN  ID,kh  B~ x B}  B}  ~ I@,p|3B+HW }  D}  F} } } ~ I?,p{ B}  D}   ~ I?,p{ B}  D} I>  ~ I>,p}3B+He }  D}  F} } ~ I>,p|3B+Hj }  D}  F} 
9 B~ ~,kk ~3B+Ho 
9 IE,kh ID,kj B~2@	+I6I;1V+Hu  ID,kh  B~ x B}  B} I=  ~ I=,p}3B+H~ }  D}  F} IC,p| IC } ~ IC,p}3B+I }  D}  F} } ~ I=,p|3B+I
 }  D}  F} } } ~ I<,p{ B}  D} IA  ~ IA,p}3B+I }  D}  F} 
9 B~ ~,kk ~3B+I 
9 IE,kh ID,kj B~2@	+I46I;1V+I  ID,kh  B~ x B}  B} I<  ~ I<,p}3B+I( }  D}  F} IC,p| } ~ I@,p|3B+I. }  D}  F} } } ~ I;,p{  
9 B~ ~,kk ~3B+I6 
9 IE,kh 
 L  B~ ,kk ~>|,~<x
G4
G5
G7<
q
G8<	B
G9
G:
G;<	C
G<
G=
G>
G?<
$
G@
GA
GB<<})0FO<=
Id(0FOQTTEBZTEBNTEP0FOSSTESPTESTTE:TTE<>
Ie/TTE$TTEX0FOTLTETRTETTTER0FOA0FOL0FOZ0FOO0FOG0FOD0FO<>
IfE0FOF0FO<>
IgI0FO<>
Ih
Ii
Ij
Ik<@<

Il<

Im<
<@<>
In<
q<@<=
Io
Ip
Iq
Ip<@
Ir<@
IQ<@<>
Is
It<@,T*
Iu
Ih<>
Iv.T*
I_
Ih> 
 Bx MS,kj B2@	+M@ MR,kj B2@	+J
 ,jG 
 B~ D~,+ MR,pv ~ ~ MQ,pw ~ ~ MQ,pv ~  B~ ,kk ~3BMP+J
x L
 MR,kj B2@	+J ,jG 
 B~ D~   MR,pv ~ ~ MP,pw ~ ~ MQ,pv ~  B~ ,kk ~ B3BMP+J  MS,kh+J  
x L
 MR,kj B2@	+J. ,jG 
 B~ D~   MR,pv ~ ~ MO,pw ~ ~ MO,pv ~  B~ ,kk ~ B3BMP+J2  MS,kh+J3 
x L
 MR,kj B2@	+JA ,jG 
 B~ D~   MR,pv ~ ~ MN,pw ~ ~ MO,pv ~  B~ ,kk ~ B3BMP+JD  MS,kh+JE 
x L
 MR,kj B2@	+JS ,jG 
 B~ D~   MR,pv ~ ~ MN,pw ~ ~ MO,pv ~  B~ ,kk ~ B3BMP+JW  MS,kh+JX 
x L
 MR,kj B2@	+Jf ,jG 
 B~ D~   MR,pv ~ ~ MM,pw ~ ~ MQ,pv ~  B~ ,kk ~ B3BMP+Ji  MS,kh+Jj 
x L
 MR,kj B2@	+Jx ,jG 
 B~ D~   MR,pv ~ ~ MM,pw ~ ~ MQ,pv ~  B~ ,kk ~ B3BMP+J|  MS,kh+J} 
x L
 MR,kj B2@	+K ,jG 
 B~ D~   MR,pv ~ ~ ML,pw ~ ~ MR,pv ~  B~ ,kk ~ B3BMP+K  MS,kh+K 
x L
 MR,kj B2@	+K ,jG 
 B~ D~   MR,pv ~ ~ ML,pw ~ ~ MR,pv ~  B~ ,kk ~ B3BMP+K!  MS,kh+K" 
x L
 MR,kj B2@	+K0 ,jG 
 B~ D~   MR,pv ~ ~ MK,pw ~ ~ MR,pv ~  B~ ,kk ~ B3BMP+K3  MS,kh+K4 
x L
 MR,kj B2@	+K> ,jG 
 B~ D~   MK,pw ~  B~ ,kk ~ B3BMP+KB  MS,kh+KC 
x L
 MR,kj B2@	+KM ,jG 
 B~ D~   MJ,pw ~  B~ ,kk ~ B3BMP+KP  MS,kh+KQ 
x L
 MR,kj B2@	+K] ,jG 
 B~ D~   MJ,pw ~ ~ MI,pw ~  B~ ,kk ~ B3BMP+Ka  MS,kh+Kb 
x L
 MR,kj B2@	+Kn ,jG 
 B~ D~   MI,pw ~ ~ MI,pw ~  B~ ,kk ~ B3BMP+Kq  MS,kh+Kr 
x L
 MR,kj B2@	+K~ ,jG 
 B~ D~   MH,pw ~ ~ MI,pw ~  B~ ,kk ~ B3BMP+L  MS,kh+L 
x L
 MR,kj B2@	+L ,jG 
 B~ D~   MR,pv ~ ~ MH,pw ~  B~ ,kk ~ B3BMP+L  MS,kh+L 
x L
 MR,kj B2@	+L ,jG 
 B~ D~   MG,pw ~  B~ ,kk ~ B3BMP+L!  MS,kh+L" 
x L
 MR,kj B2@	+L. ,jG 
 B~ D~   MG,pw ~ ~ MF,pv ~  B~ ,kk ~ B3BMP+L1  MS,kh+L2 
x L
 MR,kj B2@	+L< ,jG 
 B~ D~   MF,pw ~  B~ ,kk ~ B3BMP+L@  MS,kh+LA 
x L
 MR,kj B2@	+LK ,jG 
 B~ D~   ME,pw ~  B~ ,kk ~ B3BMP+LN  MS,kh+LO 
x L
 MR,kj B2@	+LY ,jG 
 B~ D~   ME,pw ~  B~ ,kk ~ B3BMP+L]  MS,kh+L^ 
x L
 MR,kj B2@	+Lh ,jG 
 B~ D~   MD,pw ~  B~ ,kk ~ B3BMP+Lk  MS,kh+Ll 
x L
 MR,kj B2@	+Lx ,jG 
 B~ D~   MR,pv ~ ~ MD,pw ~  B~ ,kk ~ B3BMP+L|  MS,kh+L} 
x L
 MR,kj B2@	+M ,jG 
 B~ D~   MC,pw ~  B~ ,kk ~ B3BMP+M
  MS,kh+M 
x L
 MR,kj B2@	+M ,jG 
 B~ D~   MC,pw ~  B~ ,kk ~ B3BMP+M  MS,kh+M 
x L
 MR,kj B2@	+M$ ,jG 
 B~ D~   MB,pw ~  B~ ,kk ~ B3BMP+M'  MS,kh+M( 
x L
 MR,kj B2@	+M8 ,jG 
 B~ D~   MR,pv ~ ~ MB,pw ~ ~ MA,pu ~ ~ MA,pw ~  B~ ,kk ~3BMP+M;  MS,kh+M< 
x L
 
x L
 MP B ,kk >},~
IE
IF
IG
IH
II
IJ
IK
IL
IM
IN
IO
IP
IQ
IR
IS
IT
IU<

IV<
<

IW
IX
IY
IZ
I[
I\
I]
I^
I_
I`<~
Ia
Ib
Ic<<})0FO<=
Mr(0FOQTTEBZTEBNTEP0FOSSTESPTESTTE:TTE<>
Ms/TTE$TTEX0FOTLTETRTETTTER0FOA0FOL0FOZ0FOO0FOG0FOD0FO<>
MtE0FOF0FO<>
MuI0FO<>
Mv
Mw
Mx
My<@<

Mz<

M{<
<@<>
M|<
q<@<=
M}
M~
M
M~<@
N<@
M_<@<>
N
N<@,T*
N
Mv<>
N.T*
Mm
Mv> Bx  B S,kj B2@	+S	 S,kj B~2@	+N#6S
1V+N  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+N }  D}  F} } } ~ S,p{ B}  
9 B~ ~,kk ~3B+N% 
9 S,kh S,kj B~2@	+N>6S
1V+N+  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+N8 }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+NA 
9 S,kh S,kj B~2@	+NZ6S
1V+NF  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+NS }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+N\ 
9 S,kh S,kj B~2@	+Nu6S
1V+Nb  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+No }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+Nx 
9 S,kh S,kj B~2@	+O6S
1V+N}  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+O
 }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+O 
9 S,kh S,kj B~2@	+O,6S
1V+O  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+O& }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+O/ 
9 S,kh S,kj B~2@	+OH6S
1V+O4  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+OA }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+OJ 
9 S,kh S,kj B~2@	+Oc6S
1V+OP  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+O] }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+Of 
9 S,kh S,kj B~2@	+O6S
1V+Ok  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+Ox }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+P 
9 S,kh S,kj B~2@	+P6S
1V+P  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+P }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+P 
9 S,kh S,kj B~2@	+P-6S
1V+P"  S,kh  B~ x B}  B}  ~ S,p|3B+P+ }  D}  F} 
9 B~ ~,kk ~3B+P0 
9 S,kh S,kj B~2@	+P@6S
1V+P5  S,kh  B~ x B}  B}  ~ S,p|3B+P> }  D}  F} 
9 B~ ~,kk ~3B+PC 
9 S,kh S,kj B~2@	+PY6S
1V+PH  S,kh  B~ x B}  B} S  ~ S,p}3B+PQ }  D}  F} } ~ S,p|3B+PW }  D}  F} 
9 B~ ~,kk ~3B+P\ 
9 S,kh S,kj B~2@	+Pr6S
1V+Pa  S,kh  B~ x B}  B} S  ~ S,p}3B+Pj }  D}  F} } ~ S,p|3B+Pp }  D}  F} 
9 B~ ~,kk ~3B+Pu 
9 S,kh S,kj B~2@	+Q6S
1V+Pz  S,kh  B~ x B}  B} S  ~ S,p}3B+Q }  D}  F} } ~ S,p|3B+Q	 }  D}  F} 
9 B~ ~,kk ~3B+Q 
9 S,kh S,kj B~2@	+Q#6S
1V+Q  S,kh  B~ x B}  B} }  ~ S,p{ B}  D} S  ~ S,p}3B+Q  }  D}  F} 
9 B~ ~,kk ~3B+Q% 
9 S,kh S,kj B~2@	+Q66S
1V+Q+  S,kh  B~ x B}  B} S  ~ S,p}3B+Q4 }  D}  F} 
9 B~ ~,kk ~3B+Q9 
9 S,kh S,kj B~2@	+QM6S
1V+Q>  S,kh  B~ x B}  B} S  ~ S,p}3B+QG }  D}  F} } } ~ S,p{ B}  
9 B~ ~,kk ~3B+QP 
9 S,kh S,kj B~2@	+Q`6S
1V+QU  S,kh  B~ x B}  S  ~ S,p}3B+Q] }  D}  
9 B~ ~,kk ~3B+Qb 
9 S,kh S,kj B~2@	+Qr6S
1V+Qh  S,kh  B~ x B}  S  ~ S,p}3B+Qp }  D}  
9 B~ ~,kk ~3B+Qu 
9 S,kh S,kj B~2@	+R6S
1V+Qz  S,kh  B~ x B}  S  ~ S,p}3B+R }  D}  
9 B~ ~,kk ~3B+R 
9 S,kh S,kj B~2@	+R6S
1V+R,kh  B~ x B}  S  ~ S,p}3B+R }  D}  
9 B~ ~,kk ~3B+R 
9 S,kh S,kj B~2@	+R-6S
1V+R+ S,kh  B~ x B}  }  ~ S,p{ B}  S
9 B~ ~,kk ~3B+R0 
9 S,kh S,kj B~2@	+R@6S
1V+R5+ S,kh  B~ x B}  S
9 B~ ~,kk ~3B+RB 
9 S,kh S,kj B~2@	+RR6S
1V+RH  S,kh  B~ x B}  S
  ~ S
,p}3B+RP }  D}  
9 B~ ~,kk ~3B+RU 
9 S,kh S,kj B~2@	+Re6S
1V+RZ  S,kh  B~ x B}  S
  ~ S
,p}3B+Rb }  D}  
9 B~ ~,kk ~3B+Rg 
9 S,kh S,kj B~2@	+S6S
1V+Rm  S,kh  B~ x B}  }  ~ S,p{ B}  S  ~ S,p}3B+Rx }  D}  } ~ S,pz B}  S
  ~ S
,p}3B+S }   
9 B~ ~,kk ~3B+S 
9 S,kh 
 L  B~ ,kk ~>|,~<x
MS
MT
MU
MV
MW
MX
MY
MZ
M[
M\
M]
M^
M_
M`
Ma
Mb
Mc<

Md<
<

Me
Mf
Mg
Mh
Mi
Mj
Mk
Ml
Mm
Mn
Mo
Mp
Mq<<}<{<@<<@<|<@<>
S)<>
S*)0FO<>
S+(RMATOMAGOTE=0FO<>
S,<>
S-
S#
S.
S/<@
S0<@
S#
S1
S#
S2<

S3,T*<=
S4
S5
S6<	B
S7
S"
S8
S/
S9<>
S:
S;
S<
S=
S8
S!<@
S>
S?<	C<@:0FO
S5
S8<>
S@<
SA<
<@
SB<@
SC<@<=
SD RMA
S/
SE<	B<@> 
 Bx T;,kj B2@	+T2 T;,kj B2@	+S] ,jG 
 B~ D~   T:,pw ~ ~ T:,pv ~ ~ T9,pv ~ ~ T9,pw ~ ~ T8,pw ~  B~ ,kk ~ B3BT8+Sb,pk3B+Sb   T;,kh+Sc 
x L
 T;,kj B2@	+Sq ,jG 
 B~ D~   T7,pw ~ ~ T7,pw ~ ~ T6,pw ~  B~ ,kk ~ B3BT8+Sw,pk3B+Sw   T;,kh+Sx 
x L
 T;,kj B2@	+T ,jG 
 B~ D~   T7,pw ~ ~ T7,pw ~ ~ T6,pw ~ ~ T6,pw ~ ~ T5,pv ~ ~ T5,pw ~ ~ T4,pv ~ ~ T4,pw ~  B~ ,kk ~ B3BT8+T,pk3B+T   T;,kh+T 
x L
 T;,kj B2@	+T( ,jG 
 B~ D~   T7,pw ~ ~ T7,pw ~ ~ T:,pw ~ ~ T4,pv ~ ~ T3,pv ~  B~ ,kk ~ B3BT8+T.,pk3B+T.   T;,kh+T/ 
x L
 
x L
 T8 B ,kk >},~
S<	C
S 
S!
S"
S#<

S$
S%<~<	B
S&
S'
S(<	C<<}<>
TG<>
TH)0FO<>
TI(RMATOMA RMAGOTE=0FO<>
TJ<>
TK
T@
TL
TM<@
TN<@
T@
TO
T@
TP<

TQ,T*<=
TR
TS
TT<	B
TU
T?
TV
TM
TW<>
TX
TY
TZ
T[
TV
T><@
T\
T]<	C<@:0FO
TS
TV<>
T^<
T_<
<@
T`<@
TB<@<=
Ta
TM
Tb<	B<@> Bx  B V ,kj B2@	+V V ,kj B~2@	+U6V1V+Tm  V ,kh  B~ x B}  B}  ~ V,p|3B+Tv }  D}  F} } } ~ V,p{ B}  D}   ~ V,p{ B}  D} V  ~ V,p}3B+U }  D}  F} } ~ V,p|3B+U	 }  D}  
9 B~ ~,kk ~3B+U 
9 V ,kh V ,kj B~2@	+U,6V1V+U  V ,kh  B~ x B}  B} V  ~ V,p}3B+U }  D}  F} V,p| V } ~ V,p}3B+U# }  D}  F} V,p| } ~ V,p|3B+U* }  D}  F} 
9 B~ ~,kk ~3B+U/ 
9 V ,kh V ,kj B~2@	+Uh6V1V+U4  V ,kh  B~ x B}  B} V  ~ V,p}3B+U= }  D}  F} V,p| V } ~ V,p}3B+UD }  D}  F} V,p| V } ~ V,p}3B+UK }  D}  F} } ~ V,p|3B+UQ }  D}  F} } } ~ V,p{ B}  D} V  ~ V,p}3B+U[ }  D}  F} } } ~ V,p{ B}  D} V,p| } ~ V,p|3B+Ue }  D}  F} 
9 B~ ~,kk ~3B+Uj 
9 V ,kh V ,kj B~2@	+V6V1V+Up  V ,kh  B~ x B}  B} V  ~ V,p}3B+Uy }  D}  F} V,p| V } ~ V,p}3B+V }  D}  F} V,p| } ~ V,p|3B+V }  D}  F} } } ~ V,p{ B}  D} V,p| } } ~ V,p{  
9 B~ ~,kk ~3B+V 
9 V ,kh 
 L  B~ ,kk ~>|,~<x
T<<	C
T=
T>
T?
T@<

TA
TB
TC<	B
TD
TE
TF<	C<<}<{<@<<@<|<@
D20FOR$INQUIRE-OPTIONSSS	D20FOR$IMPLICIT-TYPESIOND20FOR$INTRINSIC-ID-LISTD20FOR$INTRINSIC-ID-LIST-PRINT
D20FOR$IMPLICIT-TYPE-PRINTINTRINSICFILE<>
VU<>
VVINQUIREAS<>
VW<>
VX<>
VYFUNCTIONP<>
VZINTEGERD<>
V[<>
V\<>
V]NONEIMPLICITPTHEN<>
V^,0FO)0FO(RMAIFTEINCLUDEEN=0FO<>
V_<>
V`
Va<@
Vb
Vc
Vd<@
Ve
Vf
VN
Vg<	D<@
Vh<@
Vi<@
Vj
Vk
VL
Vl
VN
Vm
VN
Vn<=
VoUNIT
VR<@<=
Vp<
Vq
VN
Vr
Vs
Vt<=
Vu<=
Vv-T*<	C<@
Ve
Vw
Vx
Vy<	B
Vz
VL
V{
VL
V|
V}<@
V~
V<>
W
VM<@
VL
W
VL
W<
<@<>
W
W
W
W
Vt<
r<@
Ve
W RMA<>
W<
f
W	<	F<@
Ve
W
<	C
W<	C<@:0FO
Vx
Vt<>
W
<	C
W	C
W
W
Vt<
s
W
VG<@
W<@
VB
W
W<@<>
W
Ve
W<=
W
V?<@
W<@
VN
W
VL
W<=
W<	C
W<	B<@
VL
W
VG
W
Ve
W
VF
Vt
V~
W<
f<@> 
 Bx Ye,kj B2@	+YQ Yd,kj B2@	+W5 ,jG 
 B~ D~   Yd,pw ~ ~ Yc,pv ~ ~ Yc,pv ~ ~ Yb,pw ~ ~ Yb,pw ~  B~ ,kk ~ B3BYa+W;,pk3B+W;   Ye,kh+W< 
x L
 Yd,kj B2@	+WH ,jG 
 B~ D~   Ya,pw ~ ~ Y`,pw ~  B~ ,kk ~ B3BYa+WM,pk3B+WM   Ye,kh+WN 
x L
 Yd,kj B2@	+Wf ,jG 
 B~ D~   Y`,pw ~ ~ Y_,pw ~ ~ Yb,pw ~ ~ Y_,pw ~ ~ Y^,pw ~ ~ Y^,pw ~ ~ Y^,pw ~ ~ Y],pv ~  B~ ,kk ~ B3BYa+Wl,pk3B+Wl   Ye,kh+Wm 
x L
 Yd,kj B2@	+W ,jG 
 B~ D~   Y`,pw ~ ~ Y_,pw ~ ~ Yb,pw ~ ~ Y_,pw ~ ~ Y],pw ~  B~ ,kk ~ B3BYa+X,pk3B+X   Ye,kh+X 
x L
 Yd,kj B2@	+X ,jG 
 B~ D~   Y`,pw ~ ~ Y_,pw ~ ~ Yb,pw ~ ~ Y_,pw ~ ~ Y\,pw ~  B~ ,kk ~ B3BYa+X,pk3B+X   Ye,kh+X 
x L
 Yd,kj B2@	+X* ,jG 
 B~ D~   Y\,pw ~ ~ Y[,pw ~  B~ ,kk ~ B3BYa+X/,pk3B+X/   Ye,kh+X0 
x L
 Yd,kj B2@	+XH ,jG 
 B~ D~   Y\,pw ~ ~ Y[,pw ~ ~ Y_,pw ~ ~ Yd,pw ~ ~ YZ,pv ~ ~ YZ,pv ~ ~ Y_,pw ~ ~ YY,pv ~  B~ ,kk ~ B3BYa+XN,pk3B+XN   Ye,kh+XO 
x L
 Yd,kj B2@	+Xa ,jG 
 B~ D~   YY,pw ~ ~ YX,pv ~ ~ YX,pw ~ ~ Yd,pw ~ ~ YW,pv ~  B~ ,kk ~ B3BYa+Xf,pk3B+Xf   Ye,kh+Xg 
x L
 Yd,kj B2@	+X{ ,jG 
 B~ D~   YY,pw ~ ~ YX,pv ~ ~ Yd,pw ~ ~ YX,pv ~ ~ YW,pv ~ ~ YV,pv ~  B~ ,kk ~ B3BYa+Y,pk3B+Y   Ye,kh+Y 
x L
 Yd,kj B2@	+Y ,jG 
 B~ D~   YV,pw ~ ~ Y_,pw ~ ~ YU,pv ~ ~ YU,pw ~ ~ YT,pw ~ ~ YT,pv ~ ~ Y_,pw ~  B~ ,kk ~ B3BYa+Y,pk3B+Y   Ye,kh+Y 
x L
 Yd,kj B2@	+Y4 ,jG 
 B~ D~   YV,pw ~ ~ Y_,pw ~ ~ YS,pw ~ ~ Yb,pw ~ ~ YS,pw ~ ~ YT,pv ~ ~ Y_,pw ~  B~ ,kk ~ B3BYa+Y:,pk3B+Y:   Ye,kh+Y; 
x L
 Yd,kj B2@	+YG ,jG 
 B~ D~   YR,pw ~ ~ YR,pw ~  B~ ,kk ~ B3BYa+YL,pk3B+YL   Ye,kh+YM 
x L
 
x L
 Ya B ,kk >},~<
s
V8<
G
V9
V:<
r<	C
V;
V<
V>
V?
V@
VA
VB
VC
VE
VF
VG<
s
VH
VI<	8
VJ
VK
VL<

VM
VN
VO<

VP<~<	B
VR
VS
VT<	C<<}INTRINSICFILE<>
Z<>
ZINQUIREAS<>
Z<>
Z<>
ZFUNCTIONP<>
ZINTEGERD<>
Z	<>
Z
<>
ZNONEIMPLICITPTHEN<>
Z
,0FO)0FO(RMAIFTE RMAINCLUDEEN=0FO<>
Z>
Z
Z<@
Z
Z
Z<@
Z
Z
Y|
Z<	D<@
Z<@
Z<@
Z
Z
Yz
Z
Y|
Z
Y|
Z<=
ZUNIT
Z<@<=
Z<
Z
Y|
Z 
Z!
Z"<=
Z#<=
Z$-T*<	C<@
Z
Z%
Z&
Z'<	B
Z(
Yz
Z)
Yz
Z*
Y~<@
Z+
Z,<>
Z-
Y{<@
Yz
Z.
Yz
Z/<
<@<>
Z0
Z1
Z2
Z3
Z"<
r<@
Z
Z4<>
Z5<
f
Z6<	F<@
Z
Z7<	C
Z8<	C<@:0FO
Z&
Z"<>
Z9<	C
Z:<	C
Z;
Z<
Z"<
s
Z=
Yt<@
Z><@
Yp
Z?
Z1<@<>
Z@
Z
ZA<=
ZB
Yl<@
ZC<@
Y|
ZD
Yz
ZE<=
ZF<	C
ZG<	B<@
Yz
ZH
Yt
ZI
Z
ZJ
Ys
Z"
Z+
ZK<
f<@> Bx  B ^h,kj B2@	+^T ^h,kj B~2@	+Zu6^U1V+ZW  ^h,kh  B~ x B}  B}  ~ ^g,p|3B+Z_ }  D}  F} } } ~ ^g,p{ B}  D}   ~ ^f,p{ B}  D} ^f  ~ ^f,p}3B+Zm }  D}  F} } ~ ^e,p|3B+Zr }  D}  
9 B~ ~,kk ~3B+Zw 
9 ^h,kh ^h,kj B~2@	+[6^U1V+Z}  ^h,kh  B~ x B}  B} ^e  ~ ^e,p}3B+[ }  D}  F} ^d,p| } ~ ^d,p|3B+[
 }  D}  F} 
9 B~ ~,kk ~3B+[ 
9 ^h,kh ^h,kj B~2@	+[L6^U1V+[  ^h,kh  B~ x B}  B} ^c  ~ ^c,p}3B+[  }  D}  F} ^d,p| ^c } ~ ^c,p}3B+[' }  D}  F} } ~ ^e,p|3B+[, }  D}  F} ^b } ~ ^b,p}3B+[2 }  D}  F} ^d,p| } ~ ^b,p|3B+[9 }  D}  F} ^a } ~ ^a,p}3B+[? }  D}  F} ^d,p| } ~ ^b,p|3B+[E }  D}  F} } } ~ ^a,p{ B}  D} 
9 B~ ~,kk ~3B+[N 
9 ^h,kh ^h,kj B~2@	+[y6^U1V+[T  ^h,kh  B~ x B}  B} ^c  ~ ^c,p}3B+[] }  D}  F} ^d,p| ^c } ~ ^c,p}3B+[d }  D}  F} } ~ ^e,p|3B+[i }  D}  F} ^b } ~ ^b,p}3B+[o }  D}  F} ^d,p| ^` } ~ ^`,p}3B+[v }  D}  F} 
9 B~ ~,kk ~3B+[{ 
9 ^h,kh ^h,kj B~2@	+\%6^U1V+\  ^h,kh  B~ x B}  B} ^c  ~ ^c,p}3B+\
 }  D}  F} ^d,p| ^c } ~ ^c,p}3B+\ }  D}  F} } ~ ^e,p|3B+\ }  D}  F} ^b } ~ ^b,p}3B+\ }  D}  F} ^d,p| } ~ ^`,p|3B+\# }  D}  F} 
9 B~ ~,kk ~3B+\( 
9 ^h,kh ^h,kj B~2@	+\@6^U1V+\-  ^h,kh  B~ x B}  B} ^_  ~ ^_,p}3B+\6 }  D}  F} ^d,p| ^_ } ~ ^_,p}3B+\= }  D}  F} 
9 B~ ~,kk ~3B+\B 
9 ^h,kh ^h,kj B~2@	+\x6^U1V+\H  ^h,kh  B~ x B}  B} ^_  ~ ^_,p}3B+\Q }  D}  F} ^d,p| } ~ ^^,p|3B+\W }  D}  F} ^d,p| ^c } ~ ^c,p}3B+\^ }  D}  F} } ~ ^g,p|3B+\d }  D}  F} } } ~ ^^,p{ B}  D}   ~ ^],p{ B}  D} ^b  ~ ^b,p}3B+\r }  D}  F} } } ~ ^],p{ B}  D} 
9 B~ ~,kk ~3B+\{ 
9 ^h,kh ^h,kj B~2@	+]!6^U1V+]  ^h,kh  B~ x B}  B} ^\  ~ ^\,p}3B+]	 }  D}  F} } } ~ ^\,p{ B}  D} ^d,p| ^[ } ~ ^[,p}3B+] }  D}  F} ^d,p| } ~ ^g,p|3B+] }  D}  F} } } ~ ^[,p{ B}  D} 
9 B~ ~,kk ~3B+]$ 
9 ^h,kh ^h,kj B~2@	+]K6^U1V+])  ^h,kh  B~ x B}  B} ^\  ~ ^\,p}3B+]2 }  D}  F} } } ~ ^\,p{ B}  D} ^d,p| } ~ ^g,p|3B+]= }  D}  F} } } ~ ^\,p{ B}  D}   ~ ^Z,p{ B}  D}   ~ ^Z,p{ B}  D} 
9 B~ ~,kk ~3B+]N 
9 ^h,kh ^h,kj B~2@	+]6^U1V+]S  ^h,kh  B~ x B}  B} ^Y  ~ ^Y,p}3B+]\ }  D}  F} ^d,p| ^c } ~ ^c,p}3B+]c }  D}  F} } } ~ ^Y,p{ B}  D}  ~ ^X,p|3B+]m }  D}  F} } ~ ^X,p|3B+]r }  D}  F} } } ~ ^W,p{ B}  D} ^b  ~ ^b,p}3B+]| }  D}  F} 
9 B~ ~,kk ~3B+^ 
9 ^h,kh ^h,kj B~2@	+^56^U1V+^  ^h,kh  B~ x B}  B} ^Y  ~ ^Y,p}3B+^ }  D}  F} ^d,p| ^c } ~ ^c,p}3B+^ }  D}  F} ^W } ~ ^W,p}3B+^ }  D}  F} ^f } ~ ^f,p}3B+^# }  D}  F} } ~ ^V,p|3B+^( }  D}  F} } } ~ ^W,p{ B}  D} ^b  ~ ^b,p}3B+^2 }  D}  F} 
9 B~ ~,kk ~3B+^7 
9 ^h,kh ^h,kj B~2@	+^N6^U1V+^=  ^h,kh  B~ x B}  B} ^V  ~ ^V,p}3B+^F }  D}  F} ^d,p| } ~ ^U,p|3B+^K }   
9 B~ ~,kk ~3B+^P 
9 ^h,kh 
 L  B~ ,kk ~>|,~<x<
s
Ye<
G
Yg
Yh<
r<	C
Yi
Yj
Yk
Yl
Ym
Yn
Yp
Yq
Yr
Ys
Yt<
s
Yu
Yv<	8
Yx
Yy
Yz<

Y{
Y|
Y}<

Y~
Y<	B
Z
Z
Z<	C<<}<>
^j
^k<@<=
^l
^m
^n,PEA
^o
^p<
^q<	C<@
^r<@ RMA> 
,Bx ,kj+B2@	+j 
,B~ D~   
,pv ~  B~ ,kk ~3B_
+_  _,kh+_ 
x L
 
x L
 _
 B ,kk >},~<~
^i<	C<<}<>
_
_<@<=
_
_
_,PEA
_
_<
_<	C<@
_<@ RMA> Bx  B _:,kj B2@	+_7 _9,kj B~2@	+_16_81V+_#  _9,kh  B~ x B}  B}  ~ _9,p|3B+_+ }  D}  F} } } ~ _8,p{  
9 B~ ~,kk ~3B+_3 
9 _:,kh 
 L  B~ ,kk ~>|,~<x
_<	C<<}<>
_ECHARACTERLOGICALNCOMPLEXNPRECISIONDOUBLEMPREALINTEGERMP
_F
_G*T*<	E<@> 
 Bx `0,kj B2@	+`* `0,kj B2@	+_W ,jG 
 B~ D~   `/,pw ~  B~ ,kk ~3B`/+_Z  `0,kh+_[ 
x L
 `0,kj B2@	+_e ,jG 
 B~ D~   `.,pw ~  B~ ,kk ~ B3B`/+_h  `0,kh+_i 
x L
 `0,kj B2@	+_u ,jG 
 B~ D~   `.,pw ~ ~ `-,pw ~  B~ ,kk ~ B3B`/+_y  `0,kh+_z 
x L
 `0,kj B2@	+` ,jG 
 B~ D~   `-,pw ~  B~ ,kk ~ B3B`/+`  `0,kh+` 
x L
 `0,kj B2@	+` ,jG 
 B~ D~   `,,pw ~  B~ ,kk ~ B3B`/+`  `0,kh+` 
x L
 `0,kj B2@	+`# ,jG 
 B~ D~   `,,pw ~ ~ `+,pv ~  B~ ,kk ~3B`/+`&  `0,kh+`' 
x L
 
x L
 `/ B ,kk >},~
_:
_;
_=
_>
_@
_A
_C<~
_D<<}<>
`<CHARACTERLOGICALNCOMPLEXNPRECISIONDOUBLEMPREALINTEGERMP
`=
`>*T*<	E<@> Bx  B aK,kj B2@	+aE aJ,kj B~2@	+`T6aF1V+`I  aJ,kh  B~ x B}  B} aJ  ~ aJ,p}3B+`R }  D}  
9 B~ ~,kk ~3B+`W 
9 aK,kh aJ,kj B~2@	+`h6aF1V+`\  aJ,kh  B~ x B}  B} aI  ~ aI,p}3B+`e }  D}  F} 
9 B~ ~,kk ~3B+`j 
9 aK,kh aJ,kj B~2@	+a6aF1V+`p  aJ,kh  B~ x B}  B} aI  ~ aI,p}3B+`y }  D}  F} aH } ~ aH,p}3B+` }  D}  F} 
9 B~ ~,kk ~3B+a 
9 aK,kh aJ,kj B~2@	+a6aF1V+a	  aJ,kh  B~ x B}  B} aH  ~ aH,p}3B+a }  D}  F} 
9 B~ ~,kk ~3B+a 
9 aK,kh aJ,kj B~2@	+a(6aF1V+a  aJ,kh  B~ x B}  B} aG  ~ aG,p}3B+a& }  D}  F} 
9 B~ ~,kk ~3B+a+ 
9 aK,kh aJ,kj B~2@	+a?6aF1V+a0  aJ,kh  B~ x B}  B} aG  ~ aG,p}3B+a9 }  D}  F} } } ~ aF,p{  
9 B~ ~,kk ~3B+aA 
9 aK,kh 
 L  B~ ,kk ~>|,~<x
`1
`2
`3
`5
`6
`8
`9
`:<<}UNFORMATTEDCTESEQUENTIALACTERECORDTYPEHMETRECLOPENEDRINUMBERRINEXTRECOGNAMEDNHANAMEIOSTATHAFORMATTEDFORMEXISTNNTERREDIRECTHACARRIAGECONTROL-EXPBLANKNHA=CESACCESSNQ> 
 Bx dI,kj B2@	+d< dI,kj B2@	+az ,jG 
 B~ D~   dH,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~3BdG+a}  dI,kh+a~ 
x L
 dI,kj B2@	+b
 ,jG 
 B~ D~   dF,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+b  dI,kh+b 
x L
 dI,kj B2@	+b ,jG 
 B~ D~   dF,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+b"  dI,kh+b# 
x L
 dI,kj B2@	+b1 ,jG 
 B~ D~   dE,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+b5  dI,kh+b6 
x L
 dI,kj B2@	+bD ,jG 
 B~ D~   dE,pw ~ ~ dH,pw ~ ~ dD,pw ~  B~ ,kk ~ B3BdG+bG  dI,kh+bH 
x L
 dI,kj B2@	+bV ,jG 
 B~ D~   dD,pw ~ ~ dH,pw ~ ~ dC,pw ~  B~ ,kk ~ B3BdG+bZ  dI,kh+b[ 
x L
 dI,kj B2@	+bi ,jG 
 B~ D~   dC,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+bl  dI,kh+bm 
x L
 dI,kj B2@	+b{ ,jG 
 B~ D~   dB,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+b  dI,kh+c 
x L
 dI,kj B2@	+c ,jG 
 B~ D~   dB,pw ~ ~ dH,pw ~ ~ dC,pw ~  B~ ,kk ~ B3BdG+c  dI,kh+c 
x L
 dI,kj B2@	+c  ,jG 
 B~ D~   dA,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+c$  dI,kh+c% 
x L
 dI,kj B2@	+c3 ,jG 
 B~ D~   dA,pw ~ ~ dH,pw ~ ~ d@,pw ~  B~ ,kk ~ B3BdG+c6  dI,kh+c7 
x L
 dI,kj B2@	+cE ,jG 
 B~ D~   d@,pw ~ ~ dH,pw ~ ~ dC,pw ~  B~ ,kk ~ B3BdG+cI  dI,kh+cJ 
x L
 dI,kj B2@	+cX ,jG 
 B~ D~   d?,pw ~ ~ dH,pw ~ ~ dC,pw ~  B~ ,kk ~ B3BdG+c[  dI,kh+c\ 
x L
 dI,kj B2@	+cj ,jG 
 B~ D~   d?,pw ~ ~ dH,pw ~ ~ d@,pw ~  B~ ,kk ~ B3BdG+cn  dI,kh+co 
x L
 dI,kj B2@	+c} ,jG 
 B~ D~   d>,pw ~ ~ dH,pw ~ ~ dC,pw ~  B~ ,kk ~ B3BdG+d  dI,kh+d 
x L
 dI,kj B2@	+d ,jG 
 B~ D~   d>,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+d  dI,kh+d 
x L
 dI,kj B2@	+d" ,jG 
 B~ D~   d=,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~ B3BdG+d%  dI,kh+d& 
x L
 dI,kj B2@	+d4 ,jG 
 B~ D~   d=,pw ~ ~ dH,pw ~ ~ dG,pw ~  B~ ,kk ~3BdG+d7  dI,kh+d8 
x L
 
x L
 dG B ,kk >},~
aK
aM
aO
aQ
aR
aT
aU<
T
aW
aX
aY
a[
a\<	C
a]<

a_
a`
aa
ad<~<
G
ae
af<<}UNFORMATTEDCTESEQUENTIALACTERECORDTYPEHMETRECLOPENEDRINUMBERRINEXTRECOGNAMEDNHANAMEIOSTATHAFORMATTEDFORMEXISTNNTERREDIRECTHACARRIAGECONTROL-EXPBLANKNHA=CESACCESSNQ> Bx  B i),kj B2@	+i i(,kj B~2@	+e6i1V+dq  i(,kh  B~ x B}  B} i(  ~ i(,p}3B+dz }  D}  F} i' } ~ i',p}3B+e }  D}  F} } ~ i',p|3B+e }  D}  
9 B~ ~,kk ~3B+e
 
9 i),kh i(,kj B~2@	+e&6i1V+e  i(,kh  B~ x B}  B} i&  ~ i&,p}3B+e }  D}  F} i' } ~ i',p}3B+e }  D}  F} } ~ i',p|3B+e$ }  D}  F} 
9 B~ ~,kk ~3B+e) 
9 i),kh i(,kj B~2@	+eE6i1V+e.  i(,kh  B~ x B}  B} i&  ~ i&,p}3B+e7 }  D}  F} i' } ~ i',p}3B+e= }  D}  F} } ~ i',p|3B+eC }  D}  F} 
9 B~ ~,kk ~3B+eH 
9 i),kh i(,kj B~2@	+ed6i1V+eM  i(,kh  B~ x B}  B} i%  ~ i%,p}3B+eV }  D}  F} i' } ~ i',p}3B+e\ }  D}  F} } ~ i',p|3B+eb }  D}  F} 
9 B~ ~,kk ~3B+eg 
9 i),kh i(,kj B~2@	+f6i1V+el  i(,kh  B~ x B}  B} i%  ~ i%,p}3B+eu }  D}  F} i' } ~ i',p}3B+e{ }  D}  F} } ~ i$,p|3B+f }  D}  F} 
9 B~ ~,kk ~3B+f 
9 i),kh i(,kj B~2@	+f"6i1V+f  i(,kh  B~ x B}  B} i$  ~ i$,p}3B+f }  D}  F} i' } ~ i',p}3B+f }  D}  F} } ~ i#,p|3B+f  }  D}  F} 
9 B~ ~,kk ~3B+f% 
9 i),kh i(,kj B~2@	+fA6i1V+f*  i(,kh  B~ x B}  B} i#  ~ i#,p}3B+f3 }  D}  F} i' } ~ i',p}3B+f9 }  D}  F} } ~ i',p|3B+f? }  D}  F} 
9 B~ ~,kk ~3B+fD 
9 i),kh i(,kj B~2@	+f`6i1V+fI  i(,kh  B~ x B}  B} i"  ~ i",p}3B+fR }  D}  F} i' } ~ i',p}3B+fX }  D}  F} } ~ i',p|3B+f^ }  D}  F} 
9 B~ ~,kk ~3B+fc 
9 i),kh i(,kj B~2@	+f6i1V+fh  i(,kh  B~ x B}  B} i"  ~ i",p}3B+fq }  D}  F} i' } ~ i',p}3B+fw }  D}  F} } ~ i#,p|3B+f} }  D}  F} 
9 B~ ~,kk ~3B+g 
9 i),kh i(,kj B~2@	+g6i1V+g  i(,kh  B~ x B}  B} i!  ~ i!,p}3B+g }  D}  F} i' } ~ i',p}3B+g }  D}  F} } ~ i',p|3B+g }  D}  F} 
9 B~ ~,kk ~3B+g! 
9 i),kh i(,kj B~2@	+g=6i1V+g&  i(,kh  B~ x B}  B} i!  ~ i!,p}3B+g/ }  D}  F} i' } ~ i',p}3B+g5 }  D}  F} } ~ i ,p|3B+g; }  D}  F} 
9 B~ ~,kk ~3B+g@ 
9 i),kh i(,kj B~2@	+g\6i1V+gE  i(,kh  B~ x B}  B} i   ~ i ,p}3B+gN }  D}  F} i' } ~ i',p}3B+gT }  D}  F} } ~ i#,p|3B+gZ }  D}  F} 
9 B~ ~,kk ~3B+g_ 
9 i),kh i(,kj B~2@	+g{6i1V+gd  i(,kh  B~ x B}  B} i  ~ i,p}3B+gm }  D}  F} i' } ~ i',p}3B+gs }  D}  F} } ~ i#,p|3B+gy }  D}  F} 
9 B~ ~,kk ~3B+g~ 
9 i),kh i(,kj B~2@	+h6i1V+h  i(,kh  B~ x B}  B} i  ~ i,p}3B+h
 }  D}  F} i' } ~ i',p}3B+h }  D}  F} } ~ i ,p|3B+h }  D}  F} 
9 B~ ~,kk ~3B+h 
9 i),kh i(,kj B~2@	+h96i1V+h"  i(,kh  B~ x B}  B} i  ~ i,p}3B+h+ }  D}  F} i' } ~ i',p}3B+h1 }  D}  F} } ~ i#,p|3B+h7 }  D}  F} 
9 B~ ~,kk ~3B+h< 
9 i),kh i(,kj B~2@	+hX6i1V+hA  i(,kh  B~ x B}  B} i  ~ i,p}3B+hJ }  D}  F} i' } ~ i',p}3B+hP }  D}  F} } ~ i',p|3B+hV }  D}  F} 
9 B~ ~,kk ~3B+h[ 
9 i),kh i(,kj B~2@	+hw6i1V+h`  i(,kh  B~ x B}  B} i  ~ i,p}3B+hi }  D}  F} i' } ~ i',p}3B+ho }  D}  F} } ~ i',p|3B+hu }  D}  F} 
9 B~ ~,kk ~3B+hz 
9 i),kh i(,kj B~2@	+i6i1V+h  i(,kh  B~ x B}  B} i  ~ i,p}3B+i }  D}  F} i' } ~ i',p}3B+i }  D}  F} } ~ i',p|3B+i }   
9 B~ ~,kk ~3B+i 
9 i),kh 
 L  B~ ,kk ~>|,~<x
dJ
dL
dN
dP
dQ
dR
dT<
T
dU
dW
dX
dY
d[<	C
d\<

d]
d^
d`
db<
G
dd
de<<}<{<@<<@<|<@<>
i6<>
i7<>
i8FUNCTIONP<>
i9LOGICALEN=0FO<>
i:<>
i;
i<<@
i=
i>
i?
i@<	D<@
i?
iA
i?
iB<=
iC<
iD
i?
iE(T*
iF
iG
iH
iI<	B
iJ
iK
iL
iM<@
iN
iO<>
iP
iQ<@<>
iR
iS
iT
iU
iG,PEA
i=
iV RMA<>
iW<
f
iX<	F<@)0FO<	C<@:0FO
iH
iG<>
iY<	C
iZ<	C
i[
i\
iG
i]<@
i1
i^
iS<@<>
i_<=
i`
i-<@
ia<@
iK
ib<=
ic<	B<@
iK
id
i=
ie
iN
if<
f<@> 
 Bx jB,kj B2@	+j; jB,kj B2@	+i~ ,jG 
 B~ D~   jA,pw ~ ~ jA,pv ~ ~ j@,pv ~ ~ j@,pw ~ ~ j?,pw ~  B~ ,kk ~ B3Bj?+j,pk3B+j   jB,kh+j 
x L
 jB,kj B2@	+j ,jG 
 B~ D~   j>,pw ~ ~ j>,pv ~ ~ j=,pw ~ ~ jA,pw ~ ~ j=,pv ~  B~ ,kk ~ B3Bj?+j,pk3B+j   jB,kh+j 
x L
 jB,kj B2@	+j1 ,jG 
 B~ D~   j>,pw ~ ~ j>,pv ~ ~ jA,pw ~ ~ j>,pv ~ ~ j<,pv ~ ~ j<,pv ~  B~ ,kk ~ B3Bj?+j6,pk3B+j6   jB,kh+j7 
x L
 
x L
 j? B ,kk >},~
i,
i-
i.
i/
i1
i2<~<	B
i3
i4
i5<	C<<}<>
jN<>
jO<>
jPFUNCTIONP RMA<>
jQLOGICALEN=0FO<>
jR<>
jS
jT<@
jU
jV
jW
jX<	D<@
jW
jY
jW
jZ<=
j[<
j\
jW
j](T*
j^
j_
j`
ja<	B
jb
jc
jd
jG<@
je
jf<>
jg
jh<@<>
ji
jj
jk
jl
j_,PEA
jU
jm<>
jn<
f
jo<	F<@)0FO<	C<@:0FO
j`
j_<>
jp<	C
jq<	C
jr
js
j_
jt<@
jH
ju
jj<@<>
jv<=
jw
jD<@
jx<@
jc
jy<=
jz<	B<@
jc
j{
jU
j|
je
j}<
f<@> Bx  B l,kj B2@	+k| l,kj B~2@	+k&6k}1V+k  l,kh  B~ x B}  B}  ~ l,p|3B+k }  D}  F} } } ~ l,p{ B}  D}   ~ l,p{ B}  D} l  ~ l,p}3B+k }  D}  F} } ~ l,p|3B+k$ }  D}  
9 B~ ~,kk ~3B+k) 
9 l,kh l,kj B~2@	+kO6k}1V+k.  l,kh  B~ x B}  B} l  ~ l,p}3B+k7 }  D}  F} } } ~ l,p{ B}  D} l,p| k } ~ k,p}3B+kB }  D}  F} l,p| } ~ l,p|3B+kI }  D}  F} } } ~ k,p{ B}  D} 
9 B~ ~,kk ~3B+kR 
9 l,kh l,kj B~2@	+kv6k}1V+kW  l,kh  B~ x B}  B} l  ~ l,p}3B+k` }  D}  F} } } ~ l,p{ B}  D} l,p| } ~ l,p|3B+kk }  D}  F} } } ~ l,p{    ~ k~,p{    ~ k~,p{  
9 B~ ~,kk ~3B+ky 
9 l,kh 
 L  B~ ,kk ~>|,~<x
jC
jD
jE
jF
jG
jH
jI<	B
jK
jL
jM<	C<<}<{<@<<@<|<@<>
l/RMANAMELISTN=0FO<>
l<>
l
l<@
l
l
l
l<=
l(T*
l
l<	B
l
l	
l<>
l
l
l
l
l<	C
l<	C<@:0FO
l
l<>
l 
l!<@
l	
l"
l#<@)0FO<	F<@<=
l$
l%
l&,PEA<	B<@> 
 Bx li,kj B2@	+lb lh,kj B2@	+l> ,jG 
 B~ D~   lh,pw ~ ~ lg,pv ~ ~ lg,pv ~ ~ lf,pw ~ ~ lf,pw ~  B~ ,kk ~ B3Ble+lC,pk3B+lC   li,kh+lD 
x L
 lh,kj B2@	+lX ,jG 
 B~ D~   le,pw ~ ~ ld,pw ~ ~ lh,pw ~ ~ ld,pw ~ ~ ld,pw ~ ~ lc,pv ~  B~ ,kk ~ B3Ble+l^,pk3B+l^   li,kh+l_ 
x L
 
x L
 le B ,kk >},~
l<	F
l	
l
<~<	B
l
l

l	C<<}<>
lq/RMA RMANAMELISTN=0FO<>
lr<>
ls
lt<@
lu
lv
lu
lw<=
lx(T*
ly
lz<	B
l{
lj
l|<>
l}
l~
l
m
m<	C
m<	C<@:0FO
ly
m<>
m
m<@
lj
m
m<@)0FO<	F<@<=
m
m
m	,PEA<	B<@> Bx  B mn,kj B2@	+mg mm,kj B~2@	+m26mh1V+m  mm,kh  B~ x B}  B}  ~ mm,p|3B+m }  D}  F} } } ~ ml,p{ B}  D}   ~ ml,p{ B}  D} mk  ~ mk,p}3B+m+ }  D}  F} } ~ mk,p|3B+m0 }  D}  
9 B~ ~,kk ~3B+m5 
9 mn,kh mm,kj B~2@	+ma6mh1V+m:  mm,kh  B~ x B}  B} mj  ~ mj,p}3B+mC }  D}  F} mj,p| mi } ~ mi,p}3B+mJ }  D}  F} } ~ mm,p|3B+mP }  D}  F} mi } ~ mi,p}3B+mV }  D}  F} } ~ mi,p|3B+m[ }  D}  F} } } ~ mh,p{  
9 B~ ~,kk ~3B+mc 
9 mn,kh 
 L  B~ ,kk ~>|,~<x
li<	F
lj
lk
ll<	B
ln
lo
lp<	C<<}<{<@<<@<|<@	D20FOR$OPEN-OPTIONS
D20FOR$OPEN-OPTIONS-PRINT)0FO<>
m<
n(RMAOPEN=0FO<>
n<>
n
n<@<
u
n
mz
n
mz
n<=
n<	C<@
n
n	<	B
n

n
n
<>
n
n
n
n
n,PEA
n
n:0FO
n
n<>
n
mw<@<
n<
u<@
n<@
n<@<=
n RMA
n
n<	B<@> 
 Bx nY,kj B2@	+nR nY,kj B2@	+n0 ,jG 
 B~ D~   nX,pw ~ ~ nX,pv ~ ~ nW,pv ~ ~ nW,pw ~ ~ nV,pw ~  B~ ,kk ~ B3BnV+n5,pk3B+n5   nY,kh+n6 
x L
 nY,kj B2@	+nH ,jG 
 B~ D~   nU,pw ~ ~ nU,pw ~ ~ nT,pt ~ ~ nT,pv ~ ~ nS,pw ~  B~ ,kk ~ B3BnV+nN,pk3B+nN   nY,kh+nO 
x L
 
x L
 nV B ,kk >},~
mw
mx
my
mz
m{<~<	B
m|
m}
m~<	C<<})0FO<>
nc<
u
nd(RMA RMAOPEN=0FO<>
ne<>
nf
ng<@<	C<@
n]
nh
n]
ni<=
nj
nk
nl<	B
nm
nn
no<>
nd
np
nq
nr
ns,PEA
nt
nu:0FO
nk
ns<>
nv
nZ<@<
nw<
u<@
nx<@
n^<@<=
ny
nn
nz<	B<@> Bx  B oV,kj B2@	+oO oV,kj B~2@	+o#6oP1V+o  oV,kh  B~ x B}  B}  ~ oU,p|3B+o }  D}  F} } } ~ oU,p{ B}  D}   ~ oT,p{ B}  D} oT  ~ oT,p}3B+o }  D}  F} } ~ oS,p|3B+o! }  D}  
9 B~ ~,kk ~3B+o& 
9 oV,kh oV,kj B~2@	+oI6oP1V+o+  oV,kh  B~ x B}  B} oS  ~ oS,p}3B+o4 }  D}  F} oR,p| oR } ~ oR,p}3B+o; }  D}  } ~ oQ,pz B}    ~ oQ,p{ B}  oP  ~ oP,p}3B+oF }   
9 B~ ~,kk ~3B+oK 
9 oV,kh 
 L  B~ ,kk ~>|,~<x
nZ
n[
n\
n]
n^
n_<	B
n`
na
nb<	C<<}VERSIONRIUNITTYPETAPEFORMATACTESTATUSHARECTYPHARECORDTYPEHMETRECORDSIZEHMETRECORDS*RECLREADONLYIPROTECTIONACTEPARITYHAPADCHARHANAMEMODEIOSTATRIINITIALSIZEMETINITIALIZEACTEFORMFILESIZEAFILEERREDISPOSEHADIRECTORY<>
pDIALOGHADEVICEHADENSITYHACARRIAGECONTROLC-EXBUFFERCOUNTMETBLOCKSIZEBLANKNRIASSOCIATEVARIABLEXP=CESACCESSPE
p
p<
G<@> 
 Bx u,kj B2@	+u u,kj B2@	+p" ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~3Bu+p%  u,kh+p& 
x L
 u,kj B2@	+p4 ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+p7  u,kh+p8 
x L
 u,kj B2@	+pF ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+pJ  u,kh+pK 
x L
 u,kj B2@	+pY ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+p\  u,kh+p] 
x L
 u,kj B2@	+pk ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+po  u,kh+pp 
x L
 u,kj B2@	+p~ ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+q  u,kh+q 
x L
 u,kj B2@	+q ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+q  u,kh+q 
x L
 u,kj B2@	+q# ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+q&  u,kh+q' 
x L
 u,kj B2@	+q3 ,jG 
 B~ D~   u,pw ~ ~ u,pv ~  B~ ,kk ~ B3Bu+q7  u,kh+q8 
x L
 u,kj B2@	+qF ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+qI  u,kh+qJ 
x L
 u,kj B2@	+qX ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+q\  u,kh+q] 
x L
 u,kj B2@	+qk ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+qn  u,kh+qo 
x L
 u,kj B2@	+q} ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+r  u,kh+r 
x L
 u,kj B2@	+r ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+r  u,kh+r 
x L
 u,kj B2@	+r" ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+r&  u,kh+r' 
x L
 u,kj B2@	+r5 ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+r8  u,kh+r9 
x L
 u,kj B2@	+rG ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+rK  u,kh+rL 
x L
 u,kj B2@	+rZ ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+r]  u,kh+r^ 
x L
 u,kj B2@	+rl ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+rp  u,kh+rq 
x L
 u,kj B2@	+r ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+s  u,kh+s 
x L
 u,kj B2@	+s ,jG 
,B~ D~  ,uw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+s  u,kh+s 
x L
 u,kj B2@	+s$ ,jG 
,B~ D~  ,uw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+s'  u,kh+s( 
x L
 u,kj B2@	+s6 ,jG 
 B~ D~   u
,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+s:  u,kh+s; 
x L
 u,kj B2@	+sE ,jG 
 B~ D~   u
,pw ~  B~ ,kk ~ B3Bu+sH  u,kh+sI 
x L
 u,kj B2@	+sW ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+s[  u,kh+s\ 
x L
 u,kj B2@	+sj ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+sm  u,kh+sn 
x L
 u,kj B2@	+s| ,jG 
 B~ D~   u
,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+t  u,kh+t 
x L
 u,kj B2@	+t ,jG 
 B~ D~   u
,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+t  u,kh+t 
x L
 u,kj B2@	+t! ,jG 
 B~ D~   u	,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+t%  u,kh+t& 
x L
 u,kj B2@	+t4 ,jG 
 B~ D~   u	,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+t7  u,kh+t8 
x L
 u,kj B2@	+tF ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+tJ  u,kh+tK 
x L
 u,kj B2@	+tY ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+t\  u,kh+t] 
x L
 u,kj B2@	+tk ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~ B3Bu+to  u,kh+tp 
x L
 u,kj B2@	+t~ ,jG 
 B~ D~   u,pw ~ ~ u,pw ~ ~ u,pw ~  B~ ,kk ~3Bu+u  u,kh+u 
x L
 
x L
 u B ,kk >},~
oW
oX
oY<
oZ
o\
o^
o_
oa
oc
oe
of
og
oi
ok
ol
om
on
op
or
ot
ou
ov<

ow
ox
oz
o{
o|
o~
o
p
p
p
p<	C
p<~<
G
p
p
<<}VERSIONRIUNITTYPETAPEFORMATACTESTATUSHARECTYPHARECORDTYPEHMETRECORDS*RECORDSIZEHMETRECLREADONLYIPROTECTIONACTEPARITYHAPADCHARHANAMEMODEIOSTATRIINITIALSIZEMETINITIALIZEACTEFORMFILESIZEAFILEERREDISPOSEHADIRECTORY<>
uRDIALOGHADEVICEHADENSITYHACARRIAGECONTROLC-EXBUFFERCOUNTMETBLOCKSIZEBLANKNRIASSOCIATEVARIABLEXP=CESACCESSPE
uP
uS<
G<@> Bx  B }|,kj B2@	+}f }{,kj B~2@	+uu6}g1V+u_  }{,kh  B~ x B}  B} }{  ~ }{,p}3B+uh }  D}  F} }z } ~ }z,p}3B+un }  D}  F} } ~ }z,p|3B+us }  D}  
9 B~ ~,kk ~3B+ux 
9 }|,kh }{,kj B~2@	+v6}g1V+u}  }{,kh  B~ x B}  B} }y  ~ }y,p}3B+v }  D}  F} }z } ~ }z,p}3B+v
 }  D}  F} } ~ }y,p|3B+v }  D}  F} 
9 B~ ~,kk ~3B+v 
9 }|,kh }{,kj B~2@	+v36}g1V+v  }{,kh  B~ x B}  B} }x  ~ }x,p}3B+v% }  D}  F} }z } ~ }z,p}3B+v+ }  D}  F} } ~ }z,p|3B+v1 }  D}  F} 
9 B~ ~,kk ~3B+v6 
9 }|,kh }{,kj B~2@	+vR6}g1V+v;  }{,kh  B~ x B}  B} }x  ~ }x,p}3B+vD }  D}  F} }z } ~ }z,p}3B+vJ }  D}  F} } ~ }y,p|3B+vP }  D}  F} 
9 B~ ~,kk ~3B+vU 
9 }|,kh }{,kj B~2@	+vq6}g1V+vZ  }{,kh  B~ x B}  B} }w  ~ }w,p}3B+vc }  D}  F} }z } ~ }z,p}3B+vi }  D}  F} } ~ }y,p|3B+vo }  D}  F} 
9 B~ ~,kk ~3B+vt 
9 }|,kh }{,kj B~2@	+w6}g1V+vy  }{,kh  B~ x B}  B} }w  ~ }w,p}3B+w }  D}  F} }z } ~ }z,p}3B+w }  D}  F} } ~ }z,p|3B+w }  D}  F} 
9 B~ ~,kk ~3B+w 
9 }|,kh }{,kj B~2@	+w/6}g1V+w  }{,kh  B~ x B}  B} }v  ~ }v,p}3B+w! }  D}  F} }z } ~ }z,p}3B+w' }  D}  F} } ~ }z,p|3B+w- }  D}  F} 
9 B~ ~,kk ~3B+w2 
9 }|,kh }{,kj B~2@	+wN6}g1V+w7  }{,kh  B~ x B}  B} }v  ~ }v,p}3B+w@ }  D}  F} }z } ~ }z,p}3B+wF }  D}  F} } ~ }z,p|3B+wL }  D}  F} 
9 B~ ~,kk ~3B+wQ 
9 }|,kh }{,kj B~2@	+wf6}g1V+wV  }{,kh  B~ x B}  B} }u  ~ }u,p}3B+w_ }  D}  F} } } ~ }u,p{ B}  D} 
9 B~ ~,kk ~3B+wh 
9 }|,kh }{,kj B~2@	+x6}g1V+wn  }{,kh  B~ x B}  B} }t  ~ }t,p}3B+ww }  D}  F} }z } ~ }z,p}3B+w} }  D}  F} } ~ }z,p|3B+x }  D}  F} 
9 B~ ~,kk ~3B+x 
9}|,kh}{,kjBB~2@	+x$6}g1V+x  ~ }t,p}3B+x }  D}  F} }z } ~ }z,p}3B+x }  D}  F} } ~ }z,p|3B+x! }  D}  F} 
9 B~ ~,kk ~3B+x& 
9 }|,kh }{,kj B~2@	+xC6}g1V+x,  }{,kh  B~ x B}  B} }s  ~ }s,p}3B+x5 }  D}  F} }z } ~ }z,p}3B+x; }  D}  F} } ~ }s,p|3B+x@ }  D}  F} 
9 B~ ~,kk ~3B+xE 
9 }|,kh }{,kj B~2@	+xb6}g1V+xK  }{,kh  B~ x B}  B} }r  ~ }r,p}3B+xT }  D}  F} }z } ~ }z,p}3B+xZ }  D}  F} } ~ }z,p|3B+x_ }  D}  F} 
9 B~ ~,kk ~3B+xd 
9 }|,kh }{,kj B~2@	+y6}g1V+xj  }{,kh  B~ x B}  B} }r  ~ }r,p}3B+xs }  D}  F} }z } ~ }z,p}3B+xy }  D}  F} } ~ }y,p|3B+x~ }  D}  F} 
9 B~ ~,kk ~3B+y 
9 }|,kh }{,kj B~2@	+y 6}g1V+y	  }{,kh  B~ x B}  B} }q  ~ }q,p}3B+y }  D}  F} }z } ~ }z,p}3B+y }  D}  F} } ~ }z,p|3B+y }  D}  F} 
9 B~ ~,kk ~3B+y" 
9 }|,kh }{,kj B~2@	+y?6}g1V+y(  }{,kh  B~ x B}  B} }q  ~ }q,p}3B+y1 }  D}  F} }z } ~ }z,p}3B+y7 }  D}  F} } ~ }y,p|3B+y< }  D}  F} 
9 B~ ~,kk ~3B+yA 
9 }|,kh }{,kj B~2@	+y^6}g1V+yG  }{,kh  B~ x B}  B} }p  ~ }p,p}3B+yP }  D}  F} }z } ~ }z,p}3B+yV }  D}  F} } ~ }y,p|3B+y[ }  D}  F} 
9 B~ ~,kk ~3B+y` 
9 }|,kh }{,kj B~2@	+y}6}g1V+yf  }{,kh  B~ x B}  B} }p  ~ }p,p}3B+yo }  D}  F} }z } ~ }z,p}3B+yu }  D}  F} } ~ }y,p|3B+yz }  D}  F} 
9 B~ ~,kk ~3B+y 
9 }|,kh }{,kj B~2@	+z6}g1V+z  }{,kh  B~ x B}  B} }o  ~ }o,p}3B+z }  D}  F} }z } ~ }z,p}3B+z }  D}  F} } ~ }z,p|3B+z }  D}  F} 
9 B~ ~,kk ~3B+z 
9 }|,kh }{,kj B~2@	+z;6}g1V+z$  }{,kh  B~ x B}  B} }o  ~ }o,p}3B+z- }  D}  F} }z } ~ }z,p}3B+z3 }  D}  F} } ~ }z,p|3B+z8 }  D}  F} 
9 B~ ~,kk ~3B+z= 
9 }|,kh }{,kj B~2@	+zZ6}g1V+zC  }{,kh  B~ x B}  B} }n  ~ }n,p}3B+zL }  D}  F} }z } ~ }z,p}3B+zR }  D}  F} } ~ }z,p|3B+zW }  D}  F} 
9 B~ ~,kk ~3B+z\ 
9 }|,kh }{,kj B~2@	+zy6}g1V+zb  }{,kh  B~ x B}  B} }n  ~ }n,p}3B+zk }  D}  F} }z } ~ }z,p}3B+zq }  D}  F} } ~ }z,p|3B+zv }  D}  F} 
9 B~ ~,kk ~3B+z{ 
9 }|,kh }{,kj B~2@	+{6}g1V+{  }{,kh  B~ x B}  B} }m  ~ }m,p}3B+{
 }  D}  F} }z } ~ }z,p}3B+{ }  D}  F} } ~ }y,p|3B+{ }  D}  F} 
9 B~ ~,kk ~3B+{ 
9 }|,kh }{,kj B~2@	+{+6}g1V+{   }{,kh  B~ x B}  B} }m  ~ }m,p}3B+{) }  D}  F} 
9 B~ ~,kk ~3B+{. 
9 }|,kh }{,kj B~2@	+{J6}g1V+{3  }{,kh  B~ x B}  B} }l  ~ }l,p}3B+{< }  D}  F} }z } ~ }z,p}3B+{B }  D}  F} } ~ }y,p|3B+{H }  D}  F} 
9 B~ ~,kk ~3B+{M 
9 }|,kh }{,kj B~2@	+{i6}g1V+{R  }{,kh  B~ x B}  B} }l  ~ }k,p}3B+{[ }  D}  F} }z } ~ }z,p}3B+{a }  D}  F} } ~ }y,p|3B+{g }  D}  F} 
9 B~ ~,kk ~3B+{l 
9 }|,kh }{,kj B~2@	+|6}g1V+{q  }{,kh  B~ x B}  B} }l  ~ }l,p}3B+{z }  D}  F} }z } ~ }z,p}3B+| }  D}  F} } ~ }y,p|3B+| }  D}  F} 
9 B~ ~,kk ~3B+| 
9 }|,kh }{,kj B~2@	+|'6}g1V+|  }{,kh  B~ x B}  B} }k  ~ }k,p}3B+| }  D}  F} }z } ~ }z,p}3B+| }  D}  F} } ~ }z,p|3B+|% }  D}  F} 
9 B~ ~,kk ~3B+|* 
9 }|,kh }{,kj B~2@	+|F6}g1V+|/  }{,kh  B~ x B}  B} }j  ~ }j,p}3B+|8 }  D}  F} }z } ~ }z,p}3B+|> }  D}  F} } ~ }z,p|3B+|D }  D}  F} 
9 B~ ~,kk ~3B+|I 
9 }|,kh }{,kj B~2@	+|e6}g1V+|N  }{,kh  B~ x B}  B} }j  ~ }j,p}3B+|W }  D}  F} }z } ~ }z,p}3B+|] }  D}  F} } ~ }z,p|3B+|c }  D}  F} 
9 B~ ~,kk ~3B+|h 
9 }|,kh }{,kj B~2@	+}6}g1V+|m  }{,kh  B~ x B}  B} }i  ~ }i,p}3B+|v }  D}  F} } ~ }i,p|3B+|| }  D}  F} } ~ }z,p|3B+} }  D}  F} 
9 B~ ~,kk ~3B+} 
9 }|,kh }{,kj B~2@	+}#6}g1V+}
  }{,kh  B~ x B}  B} }h  ~ }h,p}3B+} }  D}  F} }z } ~ }z,p}3B+} }  D}  F} } ~ }z,p|3B+}  }  D}  F} 
9 B~ ~,kk ~3B+}% 
9 }|,kh }{,kj B~2@	+}B6}g1V+}+  }{,kh  B~ x B}  B} }h  ~ }h,p}3B+}4 }  D}  F} }z } ~ }z,p}3B+}: }  D}  F} } ~ }y,p|3B+}? }  D}  F} 
9 B~ ~,kk ~3B+}D 
9 }|,kh }{,kj B~2@	+}`6}g1V+}J  }{,kh  B~ x B}  B} }g  ~ }g,p}3B+}S }  D}  F} }z } ~ }z,p}3B+}Y }  D}  F} } ~ }y,p|3B+}] }   
9 B~ ~,kk ~3B+}b 
9 }|,kh 
 L  B~ ,kk ~>|,~<x
u
u
u<
u
u!
u#
u$
u&
u(
u*
u+
u,
u.
u0
u1
u2
u3
u5
u7
u9
u:
u;<

u<
u=
u?
u@
uA
uC
uD
uF
uH
uJ
uL<	C
uM<
G
uP
uQ<<}<{<@<<@<|<@D20FOR$STOP-CHOICEE<>
~<
~PUNCHNDPROGRAMO-<>
~)0FO<>
~<
~(RMA<>
~*RMAPRINTNTO<>
~PAUSENEN=0FO<>
~ <>
~!<>
~"<=
~#<>
~$PARAMETER
~%<@<
(
~&
~'
~(
~)<@<
(
~*
~+
~<
v<@
~
~,
~
~-
~<@
~.
~/
~<@<=
~0<
)
~1<
~2<
*<@<=
~3<
)
~4,T*
~5
~6<	B
~7<>
~8<	C
~9
~+
~:<
%<@
~;<@
~+
~<<
'
~1<>
~=
~>
~?
~@
~"
~+
~A
~
~B
~'
~C RMA
~'
~D<	C<@:0FO
~5
~"<>
~E
~'<@<	B<@
~<@
~
<@
~F<@<=
~G
~+
~B> 
 Bx 9,kj B2@	++ 8,kj B2@	+~] ,jG 
 B~ D~   8,pw ~ ~ 7,pv ~ ~ 7,pu ~ ~ 6,pv ~  B~ ,kk ~ B3B6+~b,pk3B+~b   9,kh+~c 
x L
 8,kj B2@	+~u ,jG 
 B~ D~   5,pw ~ ~ 5,pv ~ ~ 4,pv ~ ~ 4,pw ~ ~ 3,pw ~  B~ ,kk ~ B3B6+~{,pk3B+~{   9,kh+~| 
x L
 8,kj B2@	+ ,jG 
,B~3D~+,+3,pw ~ ~ 2,pv ~  B~ ,kk ~ B3B6+
x L
 8,kj B2@	+ ,jG 
 B~ D~   2,pw ~ ~ 1,pw ~ ~ 1,pv ~  B~ ,kk ~ B3B6+",pk3B+"   9,kh+# 
x L
 8,kj B2@	+1 ,jG 
 B~ D~   2,pw ~ ~ 3,pw ~ ~ 1,pv ~  B~ ,kk ~ B3B6+6,pk3B+6   9,kh+7 
x L
 8,kj B2@	+K ,jG 
 B~ D~   2,pw ~ ~ 0,pw ~ ~ 0,pt ~ ~ /,pv ~ ~ /,pw ~ ~ .,pv ~  B~ ,kk ~ B3B6+Q,pk3B+Q   9,kh+R 
x L
 8,kj B2@	+^ ,jG 
 B~ D~   .,pw ~ ~ 5,pw ~  B~ ,kk ~ B3B6+c,pk3B+c   9,kh+d 
x L
 8,kj B2@	+r ,jG 
 B~ D~   -,pw ~ ~ 1,pw ~ ~ 1,pv ~  B~ ,kk ~ B3B6+x,pk3B+x   9,kh+y 
x L
 8,kj B2@	+ ,jG 
 B~ D~   -,pw ~ ~ 3,pw ~ ~ 1,pv ~  B~ ,kk ~ B3B6+
,pk3B+
   9,kh+
x L
 8,kj B2@	+! ,jG 
 B~ D~   -,pw ~ ~ 0,pw ~ ~ -,pt ~ ~ ,,pv ~ ~ /,pw ~ ~ .,pv ~  B~ ,kk ~ B3B6+',pk3B+'   9,kh+( 
x L
 
x L
 6 B ,kk >},~
~
~
~
~
~
~
~	
~

~
~

~
~
~
~<	B
~
~
~<	C<~
~
~
~
~<<}<>
(PUNCHNDPROGRAMO-<>
((RMA<>INTNTO<>
)@<
)
v<@=
%<@<
*<@<=
',T*:0FO ^,kj B2@	+P ],kj B~2@	+"6Q1V+
  ],kh  B~ x B}  B} ]  ~ ],p}3B+ }  D}  F} \,p| } } ~ \,p{ B}  D}  ~ [,pz B}  D}   ~ [,p{ B}  
9 B~ ~,kk ~3B+$ 
9 ^,kh ],kj B~2@	+H6Q1V+*  ],kh  B~ x B}  B}  ~ Z,p|3B+2 }  D}  F} } } ~ Z,p{ B}  D}   ~ Y,p{ B}  D} Y  ~ Y,p}3B+@ }  D}  F} } ~ X,p|3B+F }  D}  F} 
9 B~ ~,kk ~3B+K 
9 ^,kh ],kj B~2@	+`6Q1V+P  ],kh  B~ x B}  B} X  ~ X,p}3B+Y }  D}  F} } } ~ W,p{ B}  D} 
9 B~ ~,kk ~3B+b 
9 ^,kh ],kj B~2@	+~6Q1V+h  ],kh  B~ x B}  B} W  ~ W,p}3B+q }  D}  F} \,p| V } ~ V,p}3B+x }  D}  F} } } ~ V,p{ B}  D} 
9 B~ ~,kk ~3B+ 
9 ^,kh ],kj B~2@	+6Q1V+  ],kh  B~ x B}  B} W  ~ W,p}3B+ }  D}  F} \,p| } ~ X,p|3B+ }  D}  F} } } ~ V,p{ B}  D} 
9 B~ ~,kk ~3B+ 
9 ^,kh ],kj B~2@	+H6Q1V+$  ],kh  B~ x B}  B} W  ~ W,p}3B+- }  D}  F} \,p| U } ~ U,p}3B+4 }  D}  F} } ~ U,pz B}  D}   ~ T,p{ B}  D} T  ~ T,p}3B+B }  D}  F} } } ~ S,p{ B}  D} 
9 B~ ~,kk ~3B+K 
9 ^,kh ],kj B~2@	+b6Q1V+P  ],kh  B~ x B}  B} S  ~ S,p}3B+Y }  D}  F} \,p| } ~ Z,p|3B+` }  D}  F} 
9 B~ ~,kk ~3B+e 
9 ^,kh ],kj B~2@	+6Q1V+j  ],kh  B~ x B}  B} R  ~ R,p}3B+s }  D}  F} \,p| V } ~ V,p}3B+z }  D}  F} } } ~ V,p{ B}  D} 
9 B~ ~,kk ~3B+ 
9 ^,kh ],kj B~2@	+6Q1V+	  ],kh  B~ x B}  B} R  ~ R,p}3B+ }  D}  F} \,p| } ~ X,p|3B+ }  D}  F} } } ~ V,p{ B}  D} 
9 B~ ~,kk ~3B+! 
9 ^,kh ],kj B~2@	+J6Q1V+'  ],kh  B~ x B}  B} R  ~ R,p}3B+0 }  D}  F} \,p| U } ~ U,p}3B+7 }  D}  F} } ~ R,pz B}  D}   ~ Q,p{ B}  D} T  ~ T,p}3B+D }  D}  F} } } ~ S,p{  
9 B~ ~,kk ~3B+L 
9 ^,kh 
LB~,kk~>|,~<x
)0FO<>
*RMAREAD
(	C<@
'@@
#@
<=
)=
(=
'
*<@<=
"<@
)@
(
&<@RMA<>
f	F<@:0FO
)@	C
%@<
(
'@
#
)
(=@<
'
!<@<
)
(
%<@
)
!
f<@> 
 Bx ",kj B2@	+ !,kj B2@	+q ,jG 
 B~ D~   !,pw ~ ~  ,pw ~ ~  ,pv ~  B~ ,kk ~ B3B+v,pk3B+v   ",kh+w 
x L
 !,kj B2@	+ ,jG 
 B~ D~   !,pw ~ ~ ,pw ~ ~ ,pw ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+,pk3B+   ",kh+ 
x L
 !,kj B2@	+  ,jG 
 B~ D~   !,pw ~ ~ ,pw ~ ~  ,pv ~  B~ ,kk ~ B3B+%,pk3B+%   ",kh+& 
x L
 !,kj B2@	+: ,jG 
 B~ D~   !,pw ~ ~ ,pw ~ ~ ,pt ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+@,pk3B+@   ",kh+A 
x L
 !,kj B2@	+S ,jG 
 B~ D~   ,pw ~ ~ ,pv ~ ~ ,pv ~ ~ ,pw ~ ~ ,pw ~  B~ ,kk ~ B3B+X,pk3B+X   ",kh+Y 
x L
 !,kj B2@	+k ,jG 
 B~ D~   ,pw ~ ~ ,pv ~ ~ ,pw ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+q,pk3B+q   ",kh+r 
x L
 !,kj B2@	+ ,jG 
 B~ D~   ,pw ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~ ~ ,pv ~ ~ ,pv ~  B~ ,kk ~ B3B+,pk3B+   ",kh+
 
x L
 !,kj B2@	+ ,jG 
 B~ D~   ,pw ~ ~  ,pw ~ ~  ,pv ~  B~ ,kk ~ B3B+ ,pk3B+    ",kh+! 
x L
 !,kj B2@	+/ ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~  ,pv ~  B~ ,kk ~ B3B+4,pk3B+4   ",kh+5 
x L
 !,kj B2@	+I ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ ,pt ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+O,pk3B+O   ",kh+P 
x L
 !,kj B2@	+\ ,jG 
 B~ D~   ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+a,pk3B+a   ",kh+b 
x L
 !,kj B2@	+t ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ ,pt ~ ~ ,pv ~ ~ ,pw ~  B~ ,kk ~ B3B+z,pk3B+z   ",kh+{ 
x L
 !,kj B2@	+ ,jG 
 B~ D~   ,pw ~ ~ ,pw ~  B~ ,kk ~ B3B+
,pk3B+
   ",kh+
x L
 
x L
	B ,kk >},~<	C
$~}<>
(REWINDRI<>
'REREADAS<>>
#>0FO<>RMAREAD
)	C<@
(@@
'@
"<@<=
)=
(
*<@<=
&<@
)>
f	F<@:0FO
%@	C
<=
<
(
'@
#
)
(=@<
'
!<@<
)
(
%<@
)
!
f<@> Bx  B 
,kj B2@	+v 
,kj B~2@	+=6w1V+'  
,kh  B~ x B}  B} 
  ~ 
,p}3B+0 }  D}  F} 
,p| 
 } ~ 
,p}3B+7 }  D}  F} } } ~ 
,p{ B}  
9 B~ ~,kk ~3B+? 
9 
,kh 
,kj B~2@	+k6w1V+E  
,kh  B~ x B}  B} 
  ~ 
,p}3B+N }  D}  F} 
,p| 
 } ~ 
,p}3B+U }  D}  F} } ~ 
,p|3B+Z }  D}  F} } } ~ 
,p{ B}  D} 
  ~ 
,p}3B+d }  D}  F} } } ~ 
,p{ B}  D} 
9 B~ ~,kk ~3B+m 
9 
,kh 
,kj B~2@	+		6w1V+s  
,kh  B~ x B}  B} 
  ~ 
,p}3B+| }  D}  F} 
,p| } ~ 
,p|3B+	 }  D}  F} } } ~ 
,p{ B}  D} 
9 B~ ~,kk ~3B+	 
9 
,kh 
,kj B~2@	+	56w1V+	  
,kh  B~ x B}  B} 
  ~ 
,p}3B+	 }  D}  F} 
,p| 
 } ~ 
,p}3B+	! }  D}  F} } ~ 
,pz B}  D}   ~ 
,p{ B}  D} 
  ~ 
,p}3B+	. }  D}  F} } } ~ 
,p{ B}  D} 
9 B~ ~,kk ~3B+	7 
9 
,kh 
,kj B~2@	+	[6w1V+	=  
,kh  B~ x B}  B}  ~ 
,p|3B+	E }  D}  F} } } ~ 
,p{ B}  D}   ~ 
,p{ B}  D}   ~ ,p}3B+	S }  D}  F} } ~ 
,p|3B+	Y }  D}  F} 
9 B~ ~,kk ~3B+	^ 
9 
,kh 
,kj B~2@	+
6w1V+	c  
,kh  B~ x B}  B}   ~ ,p}3B+	l }  D}  F} } } ~ ~,p{ B}  D} 
,p| ~ } ~ ~,p}3B+	w }  D}  F} 
,p| } ~ 
,p|3B+	~ }  D}  F} } } ~ },p{ B}  D} 
9 B~ ~,kk ~3B+
 
9 
,kh 
,kj B~2@	+
.6w1V+
  
,kh  B~ x B}  B}   ~ ,p}3B+
 }  D}  F} } } ~ ~,p{ B}  D} 
,p| } ~ 
,p|3B+
  }  D}  F} } } ~ ~,p{ B}  D}   ~ },p{ B}  D}   ~ |,p{ B}  D} 
9 B~ ~,kk ~3B+
1 
9 
,kh 
,kj B~2@	+
M6w1V+
6  
,kh  B~ x B}  B} |  ~ |,p}3B+
? }  D}  F} 
,p| 
 } ~ 
,p}3B+
F }  D}  F} } } ~ 
,p{ B}  D} 
9 B~ ~,kk ~3B+
O 
9 
,kh 
,kj B~2@	+
k6w1V+
U  
,kh  B~ x B}  B} |  ~ |,p}3B+
^ }  D}  F} 
,p| } ~ 
,p|3B+
d }  D}  F} } } ~ 
,p{ B}  D} 
9 B~ ~,kk ~3B+
m 
9 
,kh 
,kj B~2@	+6w1V+
s  
,kh  B~ x B}  B} |  ~ |,p}3B+
| }  D}  F} 
,p| 
 } ~ 
,p}3B+ }  D}  F} } ~ {,pz B}  D}   ~ {,p{ B}  D} 
  ~ 
,p}3B+ }  D}  F} } } ~ 
,p{ B}  D} 
9 B~ ~,kk ~3B+ 
9 
,kh 
,kj B~2@	+/6w1V+  
,kh  B~ x B}  B} z  ~ z,p}3B+( }  D}  F} 
,p| } } ~ z,p{ B}  D} 
9 B~ ~,kk ~3B+2 
9 
,kh 
,kj B~2@	+W6w1V+7  
,kh  B~ x B}  B} y  ~ y,p}3B+@ }  D}  F} 
,p| 
 } ~ 
,p}3B+G }  D}  F} } ~ y,pz B}  D}   ~ x,p{ B}  D} 
  ~ 
,p}3B+U }  D}  F} 
9 B~ ~,kk ~3B+Z 
9 
,kh 
,kj B~2@	+p6w1V+_  
,kh  B~ x B}  B} y  ~ y,p}3B+h }  D}  F} 
,p| } ~ x,p|3B+n }   
9 B~ ~,kk ~3B+s 
9 
,kh 
L B~ ,kk ~>|,~<x<	C
$<}<{<@<<@<|<@D20FOR$STOP-CHOICE-PRINT
,SUBROUTINE-CHO<>
-STOPSKIPRECORDHMET)0FO<>
.<
/(RMASKIPFILE<>
0<>
1SAVE=0FO<>
2<>
3
#
4<
v<@
5<@<
(
6
7<@
8<@
#
9
#
:
;
<<=
=<
)
><=
?/T*
@
A<	B
B<>
C
 <@
D
E<
"<@
D
F<>
G
H
I
J
<<
o<@,PEA
K
L
K
M<	C<@:0FO
@
<<>
N<
O
P<@
'
Q
R<@
S<@<
T<	C
U<=
V RMA<
(
W
'<@
D
X<
)
Y<	B<@<
!<@> 
 Bx ,kj B2@	+ ,kj B2@	+
p ,jG 
 B~ D~   ,pw ~ ~ ,pv ~ ~ ,pv ~ ~ ,pw ~ ~ ,pw ~  B~ ,kk ~ B3B+
v,pk3B+
v   ,kh+
w 
x L
	,kjGB2@	+
B~kD~h,pw ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~ ~ ,pv ~  B~ ,kk ~ B3B+
x L
!,kjGB2@	+
'B~kD~h,pw ~ ~ ,pw ~ ~ ,pt ~ ~ ,pv ~ ~ ,pw ~  B~ ,kk ~ B3B+
x L
4,kjGB2@	+
9B~kD~h,pw ~ ~ ,pw ~  B~ ,kk ~ B3B+
x L
L,kjGB2@	+
RB~kD~h,pw ~ ~ ,pw ~ ~ ,pt ~ ~ ,pv ~ ~ ,pw ~  B~ ,kk ~ B3B+
x L
 ,kjGB2@	+
dB~kD~h,pw ~ ~ ,pw ~  B~ ,kk ~ B3B+
x L
q,kjGB2@	+
wB~kD~h,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+
x L
 ,kj B2@	+ ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B+,pk3B+   ,kh+
 
x L
 
x L
  B ,kk >},~




<	C
 
!
"
#
$
&
'
(<~<	B
)
*
+<	C<<}<>>MET)0FO<>
((RMASKIPFILE<>>
v<@
)@
"<@<=
o<@,PEA0FO
(@
)	B<@<
!<@> Bx  B t,kj B2@	+h t,kj B~2@	+6i1V+f  t,kh  B~ x B}  B}  ~ s,p|3B+n }  D}  F} } } ~ s,p{ B}  D}   ~ r,p{ B}  D} r  ~ r,p}3B+| }  D}  F} } ~ q,p|3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 t,kh t,kj B~2@	+*6i1V+
  t,kh  B~ x B}  B} q  ~ q,p}3B+ }  D}  F} p,p| } } ~ p,p{ B}  D}  ~ s,p|3B+ }  D}  F} } } ~ p,p{ B}  D}   ~ o,p{ B}  D} 
9 B~ ~,kk ~3B+, 
9 t,kh t,kj B~2@	+R6i1V+2  t,kh  B~ x B}  B} o  ~ o,p}3B+; }  D}  F} p,p| n } ~ n,p}3B+B }  D}  F} } ~ n,pz B}  D}   ~ m,p{ B}  D} m  ~ m,p}3B+O }  D}  F} 
9 B~ ~,kk ~3B+T 
9 t,kh t,kj B~2@	+l6i1V+Z  t,kh  B~ x B}  B} o  ~ o,p}3B+c }  D}  F} p,p| } ~ l,p|3B+i }  D}  F} 
9 B~ ~,kk ~3B+n 
9 t,kh t,kj B~2@	+6i1V+t  t,kh  B~ x B}  B} l  ~ l,p}3B+} }  D}  F} p,p| n } ~ n,p}3B+ }  D}  F} } ~ n,pz B}  D}   ~ m,p{ B}  D} m  ~ m,p}3B+ }  D}  F} 
9 B~ ~,kk ~3B+ 
9 t,kh t,kj B~2@	+.6i1V+  t,kh  B~ x B}  B} l  ~ l,p}3B+% }  D}  F} p,p| } ~ l,p|3B++ }  D}  F} 
9 B~ ~,kk ~3B+0 
9 t,kh t,kj B~2@	+E6i1V+6  t,kh  B~ x B}  B} k  ~ k,p}3B+? }  D}  F} } } ~ k,p{ B}  D} 
9 B~ ~,kk ~3B+H 
9 t,kh t,kj B~2@	+b6i1V+M  t,kh  B~ x B}  B} j  ~ j,p}3B+V }  D}  F} p,p| } ~ s,p|3B+] }  D}  F} } } ~ j,p{  
9 B~ ~,kk ~3B+e 
9 t,kh 
LB~,kk~>|,~<x
 Bx ,kj B2@	+ ,kj B2@	+ ,jG 
 B~ D~   ,pw ~  B~ ,kk ~3B+  ,kh+ 
x L
 ,kj B2@	+ ,jG 
 B~ D~   ,pw ~  B~ ,kk ~3B+  ,kh+ 
x L
 
x L
  B ,kk >},~<	C<~<
<<} RMA> Bx  B P,kj B2@	+L O,kj B~2@	+36M1V+(  O,kh  B~ x B}  B} O,p| } ~ N,p|3B+1 }  D}  
9 B~ ~,kk ~3B+6 
9 P,kh O,kj B~2@	+F6M1V+;  O,kh  B~ x B}  B} O,p| } ~ N,p|3B+D }   
9 B~ ~,kk ~3B+I 
9 P,kh 
 L  B~ ,kk ~>|,~<x<	C<
<}<>
w<@ RMA> 
 Bx u,kj B2@	+r u,kj B2@	+k ,jG 
 B~ D~   t,pw ~ ~ t,pv ~  B~ ,kk ~3Bs+n  u,kh+o 
x L
 
x L
s B ,kk >},~<~
w<<}<>
w<@ RMA> Bx  B !,kj B2@	+ !,kj B~2@	+61V+
  !,kh  B~ x B}  B}  ~  ,p|3B+ }  D}  F} } } ~  ,p{  
9 B~ ~,kk ~3B+ 
9 !,kh 
L  B~ ,kk ~>|,~<x
w<<}&TTE$INT*TTE> 
 Bx j,kj B2@	+f i,kj B2@	+3 ,jG 
 B~ D~   i,pw ~  B~ ,kk ~3Bh+6  j,kh+7 
x L
 i,kj B2@	+A ,jG 
 B~ D~   h,pw ~  B~ ,kk ~ B3Bh+E  j,kh+F 
x L
 i,kj B2@	+P ,jG 
 B~ D~   g,pw ~  B~ ,kk ~ B3Bh+S  j,kh+T 
x L
 i,kj B2@	+^ ,jG 
 B~ D~   g,pw ~  B~ ,kk ~3Bh+a  j,kh+b 
x L
 
x L
hB,kkT>},~<	C> Bx  B C,kj B2@	+? B,kj B~2@	+6@1V+x  B,kh  B~ x B}  B  ~ B,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 C,kh B,kj B~2@	+6@1V+
  B,kh  B~ x B}  B  ~ A,p}3B+ }  D}  
9 B~ ~,kk ~3B+ 
9 C,kh B,kj B~2@	+'6@1V+  B,kh  B~ x B}  A  ~ A,p}3B+% }  D}  
9 B~ ~,kk ~3B+* 
9 C,kh B,kj B~2@	+96@1V+/  B,kh  B~ x B}   ~ @,p|3B+6 }   
9 B~ ~,kk ~3B+; 
9 C,kh 
LB~,kk~>},~<x<	C
(
*<@<=
),T*
%<@<>:0FO
 Bx ],kj B2@	+T \,kj B2@	+ ,jG 
 B~ D~   \,pw ~ ~ [,pv ~ ~ [,pv ~ ~ Z,pw ~ ~ Z,pw ~  B~ ,kk ~ B3BY+
,pk3B+
   ],kh+
x L
 \,kj B2@	+ ,jG 
 B~ D~   Y,pw ~ ~ X,pw ~ ~ X,pv ~  B~ ,kk ~ B3BY+!,pk3B+!   ],kh+" 
x L
 \,kj B2@	+0 ,jG 
 B~ D~   Y,pw ~ ~ Z,pw ~ ~ X,pv ~  B~ ,kk ~ B3BY+5,pk3B+5   ],kh+6 
x L
 \,kj B2@	+J ,jG 
 B~ D~   Y,pw ~ ~ W,pw ~ ~ W,pt ~ ~ V,pv ~ ~ V,pw ~ ~ U,pv ~  B~ ,kk ~ B3BY+P,pk3B+P   ],kh+Q 
x L
 
x L
YB	,kk>},~
((RMA<>RMATYPE=0FO<>
)
*<@<=
%<@,T*0FOx  B &,kj B2@	+ &,kj B~2@	+061V+  &,kh  B~ x B}  B}  ~ %,p|3B+ }  D}  F} } } ~ %,p{ B}  D}   ~ $,p{ B}  D} $  ~ $,p}3B+( }  D}  F} } ~ #,p|3B+- }  D}  
9 B~ ~,kk ~3B+2 
9 &,kh &,kj B~2@	+N61V+8  &,kh  B~ x B}  B} #  ~ #,p}3B+A }  D}  F} ",p| " } ~ ",p}3B+H }  D}  F} } } ~ !,p{ B}  D} 
9 B~ ~,kk ~3B+Q 
9 &,kh &,kj B~2@	+l61V+V  &,kh  B~ x B}  B} #  ~ #,p}3B+_ }  D}  F} ",p| } ~ #,p|3B+f }  D}  F} } } ~ !,p{ B}  D} 
9 B~ ~,kk ~3B+o 
9 &,kh &,kj B~2@	+61V+t  &,kh  B~ x B}  B} #  ~ #,p}3B+} }  D}  F} ",p| ! } ~ !,p}3B+ }  D}  F} } ~  ,pz B}  D}   ~  ,p{ B}  D}   ~ ,p}3B+ }  D}  F} } } ~ ,p{  
9 B~ ~,kk ~3B+ 
9 &,kh 
LB~,kk~>|,~<x)0FO<>
(=
)	B
"<@<>:0FO
(
)	B<@<
!<@> 
 Bx %,kj B2@	+ %,kj B2@	+i ,jG 
 B~ D~   $,pw ~ ~ $,pv ~ ~ #,pv ~ ~ #,pw ~ ~ ",pw ~  B~ ,kk ~ B3B"+n,pk3B+n   %,kh+o 
x L
 %,kj B2@	+ ,jG 
 B~ D~   !,pw ~ ~ !,pw ~ ~  ,pt ~ ~  ,pv ~ ~ ,pw ~  B~ ,kk ~ B3B"+,pk3B+   %,kh+ 
x L
 %,kj B2@	+ ,jG 
 B~ D~   !,pw ~ ~ ,pw ~  B~ ,kk ~ B3B"+,pk3B+   %,kh+ 
x L
 
x L
"B	,kk>},~<	C
((RMA RMAUNLOADEN=0FO<>
)=
"<@PEA:0FO
(
)	B<@<
!<@> Bx  B E,kj B2@	+= D,kj B~2@	+v6>1V+X  D,kh  B~ x B}  B}  ~ D,p|3B+` }  D}  F} } } ~ C,p{ B}  D}   ~ C,p{ B}  D} B  ~ B,p}3B+n }  D}  F} } ~ B,p|3B+s }  D}  
9 B~ ~,kk ~3B+x 
9 E,kh D,kj B~2@	+6>1V+~  D,kh  B~ x B}  B} A  ~ A,p}3B+ }  D}  F} A,p| @ } ~ @,p}3B+ }  D}  F} } ~ @,pz B}  D}   ~ ?,p{ B}  D} ?  ~ ?,p}3B+ }  D}  F} 
9 B~ ~,kk ~3B+  
9 E,kh D,kj B~2@	+76>1V+&  D,kh  B~ x B}  B} A  ~ A,p}3B+/ }  D}  F} A,p| } ~ >,p|3B+4 }   
9 B~ ~,kk ~3B+9 
9 E,kh 
LB~,kk~>|,~<x<	CFO<>
(@
)
*<@<=>
#@@:0FO
%RMA
"<@=
(
(	B<@<
)
)
#
&<@<
!> 
 Bx 
,kj B2@	+ ,kj B2@	+ ,jG 
 B~ D~   ,pw ~ ~ 
,pw ~ ~ 
,pv ~  B~ ,kk ~ B3B	+,pk3B+   
,kh+ 
x L
 ,kj B2@	+1 ,jG 
 B~ D~   ,pw ~ ~ 	,pw ~ ~ ,pw ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B	+6,pk3B+6   
,kh+7 
x L
 ,kj B2@	+K ,jG 
 B~ D~   ,pw ~ ~ 	,pw ~ ~ ,pt ~ ~ ,pv ~ ~ ,pw ~ ~ ,pv ~  B~ ,kk ~ B3B	+Q,pk3B+Q   
,kh+R 
x L
 ,kj B2@	+` ,jG 
 B~ D~   ,pw ~ ~ ,pw ~ ~ 
,pv ~  B~ ,kk ~ B3B	+e,pk3B+e   
,kh+f 
x L
 ,kj B2@	+x ,jG 
 B~ D~   ,pw ~ ~ ,pv ~ ~ ,pv ~ ~ ,pw ~ ~ ,pw ~  B~ ,kk ~ B3B	+~,pk3B+~   
,kh+ 
x L
 
x L
		B	,kk >},~
$~}=0FO<>
(>0FO<>RMAWRITENOF
)@
#
*<@<=>
%@@:0FO
"<@=
(
(	B<@<
)
)
#
&<@<
!> Bx  B ,kj B2@	+ ,kj B~2@	+g6
1V+Q  ,kh  B~ x B}  B}   ~ ,p}3B+Z }  D}  F} ,p|  } ~ ,p}3B+a }  D}  F} } } ~ ,p{ B}  
9 B~ ~,kk ~3B+j 
9 ,kh ,kj B~2@	+6
1V+o  ,kh  B~ x B}  B}   ~ ,p}3B+x }  D}  F} ,p|  } ~ ,p}3B+ }  D}  F} } ~ ,p|3B+ }  D}  F} } } ~ ,p{ B}  D}   ~ ,p}3B+ }  D}  F} } } ~ ,p{ B}  D} 
9 B~ ~,kk ~3B+ 
9 ,kh ,kj B~2@	+A6
1V+  ,kh  B~ x B}  B}   ~ ,p}3B+& }  D}  F} ,p|  } ~ ,p}3B+- }  D}  F} } ~ ,pz B}  D}   ~ ,p{ B}  D}   ~ ,p}3B+; }  D}  F} } } ~ ,p{ B}  D} 
9 B~ ~,kk ~3B+D 
9 ,kh ,kj B~2@	+_6
1V+I  ,kh  B~ x B}  B}   ~ ,p}3B+R }  D}  F} ,p| } ~ ,p|3B+Y }  D}  F} } } ~ ,p{ B}  D} 
9 B~ ~,kk ~3B+b 
9 ,kh ,kj B~2@	+6
1V+g  ,kh  B~ x B}  B}  ~ ,p|3B+p }  D}  F} } } ~ 
  ~ 
,p}3B+~ }  D}  F} } ~ ,p|3B+ }   
9 B~ ~,kk ~3B+ 
9 ,kh 
 L  B~ ,kk ~>|,~<x
<	C<	B
$<}<{<@<<@<|<@HASHTABLEMAKE-HASHTABLERESETHASHTABLELOOKUPORTR
HASHTABLEUNIQUEINSERTSYMHASHTABLEINSERTNSER
D20FOR$COLLECT-STMT-LABELSL' D20FOR$LABEL-HASHERCONTINUEND20FOR$DUMMY-STMTor
D20FOR$GENERATE-NEW-LABELabelTOEL	D20FOR$GENERIC-STMTD20FOR$INSERT-STATEMENTS-AFTER(%p)
D20FOR$LABEL-TRIGGER-LISTel	D20FOR$ZERO-TRIP-DO
D20FOR$ZERO-TRIP-TRANSMUTETERREALSIGNDOUBLENSTNUMERICOND20FOR$GAFSTRI
D20FOR$IMPLICIT-CLASSMUTD20FOR$ID-TRUNCATESD20FOR$CURRENT-STMT-PTRS	D20FOR$SIDE-EFFECTS	D20FOR$DO-CONST-EXPRTRTD20FOR$DO-TMP-GENR
D20FOR$EXAMINE-TYPINGRe	D20FOR$PARENS-IF-NECReD20FOR$CURRENT-XPEXD20FOR$PREV-XPPOSITIVENNEGATIVENVARIABLES	D20FOR$DECLARE-LISTARRAYSSFARRAYARGUMENTFSTMTFUNCTIONFFD20FOR$EXPRESSION-MODESuBASESTRING2INTPARAMETERINTEGERCOHOLLERITHOCTALCONS> Bx,k: B x@@ ,jf  B8 >,~> Bx   B @@,jf x B8 Z" B D~ ~ ,jg3B+ + .x  D ,ji B+>~,~> Bx D   ,j{,ji   D~ .x   F3F+/  B~ F~600V+  +!   B} D}610V+%3@}+& }+/  },jT3B+) 

9 L} ~  D~610V+- +.  B}+" >|,~<<~<> Bx D   ,j{,ji   B D~6r1v+<1V+< +q .x   F3F+`  B~ F~6r0V+C +C   B} D}6s0V+G3@}+W2@}+V  ,j< B ~.x B,j; x   ,jg3B+U x   ,ji B| x 8 8 B8 
9+q +q  },jR3B+Z 

9 L} ~  D~6s0V+^ +_  B}+E x   Z",jg3B+h x   ,ji x 8 8 B8 ,jG ~.x B x    ,k x 8 8 8 B8 
9>|,~<<<~<> Bx D   ,j{,ji   B D~6+1v+~1V+~ +* .x   F3F+!  B~ F~6+0V+ +   B} D}6,0V+	3@}+2@}+  ,j< B ~.x B ,j; x   ,jg3B+ x   ,ji B| x 8 8 B8 
9+*  },jR3B+ 

9 L} ~  D~6,0V+  +   B}+ ,jG ~.x B x    ,k x 8 8 8 B8 
9>|,~<<<~<BADLABELSA duplicate or incorrect label (%p) was found.d > Bx ,tj  
x L6X0V+;  +;   B D~6X1V+? +W  
\3L8+R3@w+E  8 8 
[3L8+R  ,nd2B[+R       D~ ,tk2B+R ~ Z,j>  Z Y,s%   B6Y0V+V +V  B+=>~,~<<<l
GOTO %p added by TRANSFORTel%pMS<
|<@dded by TRANSFORTel> Bx,tn B  ,jm B  ,j>  ,jm 
   x   ,k? B  ,jm B~  ,j>  ,jm   ,jf B~  ,j>  ,jm 
~~ x   ,k? >}+j|
~<
	6	7ded,byTRANSFORT> Bx D3F+  ,jm B,2,j< ,j|+  ,j< x  ,j|,>~+j|<	6,k B x   ,j< B~ x B8+' >~,~<	7> Bx,jG  B D2@+8 +#     D @| 
    B~ D~ F} H} J| 
| L|   D{ D{  Bz3B+E +F 
92B+I 
96#1V+I 3B+    D{3B#+N +N 
93B+ 6#0V+j  Bz  D{   Bz Dz Dz  By3B+X +Y 
92B+\ 
96#1V+\ 3B+k  By  Dz3B#+a +b 
93B+k3D+g  By  Dz B~ 
9+h 3B+k 
93D+k 3B+ 3@{+q {  Bz {  D{ B} 
9+r 3B+  {  {  D{3B#+w +x 
93B+ 3D+}  Bz  D{ B} 
9+~ 3B+    D{3B#+  +  
93B+ 3D+   Bz  D{ B| 
9+	3B+    D{3B#+ 
93B+ 3D+   Bz  D{ B| 
9+  3B+  
93D+  3B+  
| | } } ~,tq+6 ~  B{ D{ D{  Bz3B+ ! + ! 
92B+ % 
96#1V+ % 3B+ i  Bz  D{3B#+ * + * 
93B+ i6#0V+ F  Bz  D{   Bz Dz Dz  By3B+ 4 + 5 
92B+ 8 
96#1V+ 8 3B+ G  By  Dz3B#+ = + > 
93B+ G3D+ C  By  Dz B~ 
9+ D 3B+ G 
93D+ G 3B+ i3@{+ M {  Bz {  D{ B} 
9+ N 3B+ i {  Bz {  D{3B#+ T + T 
93B+ i3D+ Z  Bz  D{ B} 
9+ Z 3B+ i  Bz  D{3B#+ _ + ` 
93B+ i3D+ e  Bz  D{ B| 
9+ f 3B+ i 
93D+ i 3B+ m 
 | } } ~,tq+6 ~  B{ D{ D{  Bz3B+ s + s 
92B+ w 
96#1V+ w 3B+!K  Bz  D{3B#+ | + | 
93B+!K6#0V+!  Bz  D{   Bz Dz Dz  By3B+! +! 
92B+!
 
96#1V+!
 3B+!  By  Dz3B#+! +! 
93B+!3D+!  By  Dz B~ 
9+! 3B+! 
93D+! 3B+!K {  Bz {  D{3B#+! +! 
93B+!K3D+!%  Bz  D{ B} 
9+!% 3B+!K  Bz  D{3B#+!* +!+ 
93B+!K3D+!0  Bz  D{ B} 
9+!1 3B+!K  Bz  D{3B#+!6 +!6 
93B+!K3D+!<  Bz  D{ B| 
9+!< 3B+!K  Bz  D{3B#+!A +!B 
93B+!K3D+!G  Bz  D{ B| 
9+!H 3B+!K 
93D+!K 3B+!O 
| | } } ~,tq+6 ~  B{ D{ D{  Bz3B+!U +!U 
92B+!Y 
96#1V+!Y 3B+"!  Bz  D{3B#+!^ +!^ 
93B+"!6#0V+!z  Bz  D{   Bz Dz Dz  By3B+!h +!i 
92B+!l 
96#1V+!l 3B+!{  By  Dz3B#+!q +!r 
93B+!{3D+!w  By  Dz B~ 
9+!x 3B+!{ 
93D+!{ 3B+"! {  Bz {  D{3B#+" +" 
93B+"!3D+"  Bz  D{ B} 
9+" 3B+"!  Bz  D{3B#+"
 +"
93B+"!3D+"  Bz  D{ B} 
9+" 3B+"!  Bz  D{3B#+" +" 
93B+"!3D+"  Bz  D{ B| 
9+" 3B+"! 
93D+"! 3B+"& 
 | } } ~,tq+6 ~  B{ D{ D{  Bz3B+"+ +", 
92B+"/ 
96#1V+"/ 3B+"`  Bz  D{3B#+"4 +"5 
93B+"`3D+":  Bz  D{ B} 
9+"; 3B+"`  Bz  D{3B#+"@ +"@ 
93B+"`3D+"F  Bz  D{ B} 
9+"F 3B+"`  Bz  D{3B#+"K +"L 
93B+"`3D+"Q  Bz  D{ B| 
9+"R 3B+"`  Bz  D{3B#+"W +"W 
93B+"`3D+"]  Bz  D{ B| 
9+"] 3B+"` 
93D+"` 3B+"e 
| | } } ,tq+6 ~  B{ D{ D{  Bz3B+"j +"k 
92B+"n 
96#1V+"n 3B+#  Bz  D{3B#+"s +"t 
93B+#3D+"y  Bz  D{ B} 
9+"z 3B+#  Bz  D{3B#+" +" 
93B+#3D+#  Bz  D{ B} 
9+# 3B+#  Bz  D{3B#+#
 +# 
93B+#3D+#  Bz  D{ B| 
9+# 3B+# 
93D+# 3B+6 
 | } } ,tq+6 >y,~<z<<y<<<
<rONETRIPESDO-loop modified to execute once.d<@<@<

2


@ZERTRIPDOA Zero-Trip DO loop was encounteredzeroZERINCRESA DO loop has an increment value of zeroound<<@
<@1TEG1.0-<
<@> Bx D F H~ J~ ,jG B} ,tt @| @| @| @| @|Z*       }  B} D| F| H{ J{ 
| Lz 
| Lz 
| Ly 
| Ly 
| Lx @| @| @| 
     Bx Dw Fw Hv Jv 
| Lu 
| Lu 
| Lt |2@8+#h ,tt Bt  | D8  | F8 | 
&@ L8 {,tu B{ 
 
0 
06&/0V+#     Bt6&/1V+#q +#r 
93B+#v t 3B&?+#v +#v 
93B+#       D}     Bt  8 B8   ,tv Bz ~  ,tv By   ,tv By ~  ,tv Bx3@~+$ ~  ,tv Bx ~  ,tv Bw6&/1v+$1V+$  Bw+$Z, Lw  Dx2@z+$2@y+$13@y+$3@w+$3@x+$1 {,ji |    F{ x {,tw Bw  &?,jm Bt    &>,jm  &> t,jf }  ,to  |,jG w &?,jm,jG  &=,jm  &=,jm  &>,jm B  D}3@y+$33@w+$52@x+$L3@x+$L {,ji |    F{ x {,tw Bv  &?,jm Bt ~   &>,jm  &> t,jf }  ,to  |,jG v &?,jm,jG  &=,jm  &=,jm  &>,jm B~  D}3@x+$d {,ji |    F{ x {,tw Bv  &?,jm Bt ~   &>,jm  &> t,jf }  ,to  |,jG v &?,jm,jG  &=,jm  &=,jm  &>,jm B~  D}3@w+%9@@ w,jg2B+$l w,jh3B+$j &<+$m &< &; &;,s% &: Bu3@y+%$3@x+%$  Bt 
9 
y3L
9+$s 2B+% 
9 
x3L
9+$v 2B+% 
9 
u3L&:+$z 3B+$~ x y,jg3B+$~ 
9 Bt2B+% 
9 
u3L&<+% 3B+% x y,j~3B+% 
9 Bt Bs3@t+% &: &9 &9,s% 

9 Ls3@s+%" 

9 Lz 
u2L&:+% &8+% 
u2L&<+% &8+%   &?,jm Bs    &>,jm Br ~   &>,jm &7,j< &7,j| r,j| &6,j| s,j|  &=,jm  &=,jm+& 
~ Lt+& 

9 Lz2B&:+%' &8+%)2B&<+%) &8+%)   &?,jm Bt    &>,jm Bs ~   &>,jm &7,j< &7,j| s,j| &6,j| t,j|  &=,jm  &=,jm+& {,ji |    x {,tw Bu 

9 Lz  &?,jm Bt  ~,tw &6,k3B+%E &5+%F &5,jG  &=,jm  &=,jm  &>,jm Bs &7 ~,j< &7,j| s,j| &6,j| &4,j|  &=,jm  &=,jm  &>,jm  &> t,jf }  ,to  |,jG  B} 

9Lzu &?,jm,jG  &=,jm  &=,jm Bt u &?,jm,jG  &=,jm  &=,jm Bs   ,tx  &4 s &3,jn  &>,jm Bs u &?,jm,jG  &=,jm  &=,jm Bs ~  ,tx  &4 s &3,jn  &>,jm &7,j< &7,j| s,j| &6,j| &3,j|  &=,jm  &=,jm  &4 t &3,jn  &2,jm Bt | &2,jT2B+&
 L8 |   B83@z+& &1 &1 &9,s%3@x+& x &0,jm,jG+&  Bt t   &>,jm Bs3@~+& ~   &>,jm  &7,jm+&  s,j| &7,j| ,j| &>,j| ,j|  t,jI &0,j|  8 8 B83@}+&- } &?,jm   ,j<  8 B8+&. >r,~<0<<r<

P
3<
2<
4<<
X<
<	7<	DO-FO>FxH,tu,j7[Bx,jG,k>&R,jI,jI~&Q,jI,l	}BZ&|,jfd,j<dB >~,~
92B+&h 
96'#1V+&h 3B+'
   D}3B'&+&l +&m 
93B+'
6'#0V+'	  B|  D}   B| D| D|  B{3B+&w +&w 
92B+&{ 
96'$1V+&{ 3B+'	  B{  D|3B'%+' +' 
93B+'	3D+'  B{  D| B~ 
9+' 3B+'	 
93D+'	 3B+'
 
93@}+'
 3B+' 
~ L+&Y ~  B} D} D}  B|3B+' +' 
92B+' 
96'#1V+' 3B+' D~ 
93B+&Y '% ~,j< '$,j| '%,j|  '&,jm B+&Y >{,~<|<<{
4<
2<
<<@>
 Bx,jG  B D2@+'. +-g     D @| @| 
    B~ D~ F} H} J| 
| L| 
| L{   Dz D{  Bz3B+'= +'= 
92B+'A 
96-h1V+'A 3B+(Z   Dz3B-s+'E +'F 
93B+(Z ,jG Bz3@z+( 
z6-i0V+(	 z   By Dy Dy  Bx3B+'Q +'R 
92B+'U 
96-i1V+'U 3B+(
  Bx  Dy3B-r+'Z +'[ 
93B+(
6-j0V+(  Bx  Dy   Bx Dx Dx  Bw3B+'e +'e 
92B+'i 
96-j1V+'i 3B+(6-j0V+(  Bw  Dx   Bw Dw Dw  Bv3B+'s +'s 
92B+'w 
96-k1V+'w 3B+(  Bv  Dw3B-r+'| +'| 
93B+(3D+(  Dw 
9+( 3B+( 
93D+( 3B+( 
93@x+( 3B+(
 
93@y+(
 3B+(| 
9+( z  z  Dz  z,jG Bz+'H3B+(Z6-k0V+(W z  Bz z  Dz   Bz Dy Dz  By3B+( +( 
92B+(! 
96-l1V+(! 3B+(W  By  Dy3B-r+(& +(' 
93B+(W6-j0V+(T  By  Dy   By Dx Dy  Bx3B+(1 +(1 
92B+(5 
96-l1V+(5 3B+(T6-j0V+(Q  Bx  Dx   Bx Dw Dx  Bw3B+(? +(? 
92B+(C 
96-m1V+(C 3B+(Q  Bw  Dw3B-r+(H +(H 
93B+(Q3D+(N  Bw  Dw B~ 
9+(N 3B+(Q 
93D+(Q 3B+(T 
93@x+(T 3B+(W 
93@y+(W 3B+(Z 
93@z+(Z 3B+(]  D+', ~  B{ Dz D{  Bz3B+(b +(c 
92B+(f 
96-h1V+(f 3B+*/  Bz  Dz3B-s+(k +(l 
93B+*/ ,jG Bz3@z+)E 
z6-i0V+)C z   By Dy Dy  Bx3B+(w +(x 
92B+({ 
96-i1V+({ 3B+)D  Bx  Dy3B-r+) +) 
93B+)D6-j0V+)@  Bx  Dy   Bx Dx Dx  Bw3B+) +) 
92B+) 
96-j1V+) 3B+)A6-j0V+))  Bw  Dx   Bw Dw Dw  Bv3B+) +) 
92B+) 
96-k1V+) 3B+)*  Bv  Dw3B-r+)" +)" 
93B+)*3D+)&  Dw 
9+)' 3B+)* 
93D+)* 3B+)A x  Bw x  Dx3B-q+)0 +)0 
93B+)A3@x+)4 
x 
02L-q+)5 
9+)7 x  Bx+)13B+)A x  Bw x  Dx3B-q+)= +)> 
93B+)A 
93D+)A 3B+)D 
93@y+)D 3B+)G z  B| 
9+)M z  By z  Dz  z,jG Bz+(n3B+*/6-k0V+*, z  Bz z  Dz   Bz Dy Dz  By3B+)X +)X 
92B+)\ 
96-l1V+)\ 3B+*,  By  Dy3B-r+)a +)a 
93B+*,6-j0V+*)  By  Dy   By Dx Dy  Bx3B+)k +)l 
92B+)o 
96-l1V+)o 3B+*)6-j0V+*  Bx  Dx   Bx Dw Dx  Bw3B+)y +)z 
92B+)} 
96-m1V+)} 3B+*
  Bw  Dw3B-r+* +* 
93B+*
3D+*  Bw  Dw B~ 
9+*	 3B+*
 
93D+*
 3B+*) x  Bx x  Dx3B-q+* +* 
93B+*) ,jG Bx3@x+* 
x 
02L-q+* x  B{ 
9+*  x  Bw x  Dx  x,jG Bx+*3B+*) x  Bx x  Dx3B-q+*& +*& 
93B+*) 
93D+*) 3B+*, 
93@y+*, 3B+*/ 
93@z+*/ 3B+*d ~,tt    B{ Dz Fz -p ,k3B+*J  By 
{ Ly6-m0V+*< y +*<  By6-m1V+*? +*b 
y3L-p+*E y  ,')3B+*E 

9 L{ y  By6-n0V+*I +*I  By+*= z 
-o2L8+*a { z  By Dy2@y+*Q +*\ y 
-p2L8+*U y  By+*O y 8 
y 
0 
0 
0 L8 y  By y  Dy+*O z  z ,k Bz  ,') B{+*b 

9 L{ { B+', ~  B{ Dz D{  Bz3B+*i +*j 
92B+*m 
96-h1V+*m 3B++[  Bz  Dz3B-s+*r +*s 
93B++[ ,jG Bz3@z++! 
z6-i0V++  z   By Dy Dy  Bx3B+*~ +* 
92B++ 
96-i1V++ 3B++   Bx  Dy3B-r++ ++ 
93B++ 6-j0V++  Bx  Dy   Bx Dx Dx  Bw3B++ ++ 
92B++ 
96-j1V++ 3B++3D++  Dx 
9++ 3B++ 
93D++ 3B++  
93@y++  3B++$ z  B| 
9++) z  By z  Dz  z,jG Bz+*u3B++[6-k0V++W z  Bz z  Dz   Bz Dy Dz  By3B++4 ++5 
92B++8 
96-l1V++8 3B++X  By  Dy3B-r++= ++> 
93B++X6-j0V++T  By  Dy   By Dx Dy  Bx3B++H ++H 
92B++L 
96-l1V++L 3B++U3D++Q  Bx  Dx B~ 
9++R 3B++U 
93D++U 3B++X 
93@y++X 3B++[ 
93@z++[ 3B++]  D+', ~  B{ Dz D{  Bz3B++c ++c 
92B++g 
96-h1V++g 3B+-  Bz  Dz3B-s++l ++l 
93B+- ,jG Bz3@z+,8 
z6-i0V+,7 z   By Dy Dy  Bx3B++x ++x 
92B++| 
96-i1V++| 3B+,7  Bx  Dy3B-r+, +, 
93B+,76-j0V+,  Bx  Dy   Bx Dx Dx  Bw3B+, +,
 
92B+, 
96-j1V+, 3B+,  Bw  Dx3B-q+, +, 
93B+, 
93D+, 3B+,73@y+, y  By 
9+, 3B+,76-l0V+,4 y  Bx y  Dy   Bx Dx Dx  Bw3B+,( +,( 
92B+,, 
96-j1V+,, 3B+,4  Bw  Dx3B-q+,1 +,1 
93B+,4 
93D+,4 3B+,7 
93@y+,7 3B+,; z  B| 
9+,@ z  By z  Dz  z,jG Bz++o3B+-6-k0V+-
 z  Bz z  Dz   Bz Dy Dz  By3B+,K +,L 
92B+,O 
96-l1V+,OD3B+- +,U 
93B+-+,k  By  Dy   By Dx Dy  Bx3B+, +, 
92B+,c 
96-l1V+,c 3B+,k  Bx  Dx3B-q+,h +,h 
93B+,k 
93D+,k3B+- y  Dy B~ 
9+,rV3B+-  By y  Dy   By Dx Dy  Bx3B+,} +,~ 
92B+- 
96-l1V+- 3B+-
  Bx  Dx3B-q+- +- 
93B+-
 
93D+-
 3B+-
93@y+-+- 
93@z+- 3B+- ~,') B+', ~  B{ Dz D{  Bz3B+- +- 
92B+- 
96-h1V+- 3B+-_  Bz  Dz3B-o+-! +-" 
93B+-_3D+-'  Bz  Dz B| 
9+-( 3B+-_6-j0V+-U  Bz  Dz   Bz Dy Dz  By3B+-2 +-2 
92B+-6 
96-l1V+-6 3B+-U  By  Dy3B-n+-; +-; 
93B+-U6-j0V+-R  By  Dy   By Dx Dy  Bx3B+-E +-F 
92B+-I 
96-l1V+-I 3B+-R3D+-O  Bx  Dx B} 
9+-O 3B+-R 
93D+-R 3B+-U 
93@y+-U 3B+-_3@z+-\ z  Bz z  Dz B} 
9+-\ 3B+-_ 
93@z+-_ 3B+', |,')2B+-d },')3B+-e 
9+-f  B+', >v,~<z<0<x<<w<v<z<y<x<w<y<<
2<
3<<
<
4<
2<
1!x,jG  B D2@+-~ +19     D @| 
    B~ D~ F} H} J| 
| L|   D{ D{  Bz3B+.
 +.
 
92B+. 
961:1V+. 3B+.E   D{3B1N+. +. 
93B+.E61;0V+.B  Bz  D{   Bz Dz Dz  By3B+. +. 
92B+.# 
961;1V+.# 3B+.B  By  Dz3B1M+.( +.( 
93B+.B61;0V+.?  By  Dz   By Dy Dy  Bx3B+.2 +.3 
92B+.6 
961<1V+.6 3B+.?3D+.<  Bx  Dy B~ 
9+.< 3B+.? 
93D+.? 3B+.B 
93@z+.B 3B+.E 
93@{+.E 3B+/61<0V+.I ~ +.J ~ B{2B1M+.Q  1L,j< B ~  Z",t} B{+.2B1L+.W  1K,j< B ~  Z",t} B{+.2B1K+.^  1J,j< B ~  Z",t} B{+.2B1J+.d  1I,j< B ~   1I,t} B{+.2B1H+.k  1H,j< B ~   1I,t} B{+.3B1G+.2B1G+.v ~  ,tt B{ 
1F2L+.u  ,j< B {  Bz+.~ +.2B1F+.z  1E,j< B 1E B{+.2B1D+.  1E,j< B@@ B{+.  B+-| ~  B{ D{ D{  Bz3B+/ +/ 
92B+/
 
961:1V+/
 3B+/^  Bz  D{3B1N+/ +/ 
93B+/^61;0V+/Z  Bz  D{   Bz Dz Dz  By3B+/ +/ 
92B+/ 
961;1V+/ 3B+/[  By  Dz3B1M+/" +/# 
93B+/[61;0V+/9  By  Dz   By Dy Dy  Bx3B+/- +/- 
92B+/1 
961<1V+/1 3B+/9  Bx  Dy3B1D+/6 +/6 
93B+/9 
93D+/9 3B+/[3@z+/@ z  By z  Dz B~ 
9+/@ 3B+/[61=0V+/W z  By z  Dz   By Dy Dy  Bx3B+/K +/L 
92B+/O 
961<1V+/O 3B+/X  Bx  Dy3B1C+/T +/U 
93B+/X 
93D+/X 3B+/[ 
93@z+/[ 3B+/^ 
93@{+/^ 3B+/a ~,-y B{ B+-| ~  B{ D{ D{  Bz3B+/g +/g 
92B+/k 
961:1V+/k 3B+0X  Bz  D{3B1N+/p +/p 
93B+0X ,jG Bz3@{+0 
{61=0V+0 {   Bz Dy Dz  By3B+/| +/| 
92B+0 
961>1V+0 3B+0  By  Dy3B1M+0 +0 
93B+061;0V+0  By  Dy   By Dx Dy  Bx3B+0 +0 
92B+0 
961>1V+0 3B+03D+0  Dx 
9+0 3B+0 
93D+0 3B+0 
93@y+0 3B+0! z  B| 
9+0' {  Bz {  D{  z,jG Bz+/s3B+0X61?0V+0U {  Bz {  D{   Bz Dz Dz  By3B+02 +02 
92B+06 
961;1V+06 3B+0U  By  Dz3B1M+0; +0; 
93B+0U61;0V+0R  By  Dz   By Dy Dy  Bx3B+0E +0F 
92B+0I 
961<1V+0I 3B+0R3D+0O  Bx  Dy B~ 
9+0O 3B+0R 
93D+0R 3B+0U 
93@z+0U 3B+0X 
93@{+0X 3B+0x  B{ 
| L{61?0V+0^ { +0_  B{ ~,jG  1M,jm  1N,jm,-y  { Bz Dz61?0V+0h2@z+0i z+0w 1C z,jT3B+0n z,jz Bz+0r 1C z,jT3B+0r z,kG Bz {  B{61@0V+0v +0v  Bz+0f B+-| ~  B{ D{ D{  Bz3B+0~ +0~ 
92B+1 
961:1V+1 3B+1  Bz  D{3B1B+1 +1 
93B+13D+1 B| 
9+13B+13D+1  Bz  D{ B} 
9+1 3B+13D+1  Bz  D{ B} 
9+1 3B+1 
93D+1 3B+-| |,-y B{ },-y  { B{ Dz3B+173D+1761@1V+1&0v+1661;1V+1)0v+16 }    Bz2B1B+1. {,jj+182B1A+10 {,jh+182B1A+13 {,ji+182B1@+15 {,jj+18 
9+18 
9+18  B+-| >w,~<z<<y<x<~<z<0<y<x<{<{<<<<<<
3<<
\
B<
[<
<
<<
<
<
<<
<<
<
4<
2<
<@<
<@<	h<@<
|<@<
<@<<@<<@<<@BLOCKYPE-PROGRAME-SUBROUTINECTIOD20FOR$TRANSMUTEDCL
D20FOR$INTRINSIC-LIST-INITE
D20FOR$INITIALIZE-IMPLICITED20FOR$LAST-IMPLICIT-PTR
D20FOR$CURRENT-SECTIONR	D20FOR$DISPLAY-TREED20FOR$PROCESS-STATEMENT
D20FOR$INSERT-DECLARATIONSE
D20FOR$DO-IDENTIFIER-RESETE
D20FOR$RESET-NAMELISTESE
D20FOR$RESET-IMPLICITESED20FOR$RESET-GAFSCID20FOR$RESET-ISF-OR-SARGDATAEND-BACKFILE-WRITEYPE-UNLOADE-ACCEPTPE-COMPLEXE-SKIPFILE-SKIPRECORDSS-PUNCHCORDENCODEORDDECODEORDREREADORD	D20FOR$ASSIGNED-GOTOn-poD20FOR$PROCESS-IMPLICITD20FOR$PROCESS-PARAMETER
D20FOR$GENERAL-DECLARER
D20FOR$DECLARE-DIMENSIONStablD20FOR$PROCESS-INTRINSIC
D20FOR$PROCESS-EQUIVALENCEablD20FOR$PROCESS-EXTERNALCD20FOR$DO-FORMATTERD20FOR$PROCESS-IFER	D20FOR$PROCESS-CALLD20FOR$PROCESS-DOL
D20FOR$PROCESS-COMMONLC	D20FOR$PROCESS-DATAD20FOR$COLLECT-NAMELIST-NAMES	D20FOR$PROCESS-OPEN	D20FOR$PROCESS-CLOSEST-N
D20FOR$REDO-FMT-TO-NML-N
D20FOR$PROCESS-WRITES-ND20FOR$PROCESS-STMT-FUNC
D20FOR$CHECK-BAD-ARGSNC	D20FOR$DO-IDENTIFIERNCNAMELIST-FORMATPE-EQUIVALENCES-INTRINSICDIMENSIONIMPLICIT-EXAMINEDNAMENTEXAMINENAMEST
D20FOR$TOP-LEVEL-PATHL-LASSIGNMMEENDFILEFINDPAUSEEREWINDSAVESTOP	D20FOR$IMPLICIT-OPENPTR
D20FOR$OPEN-FILE-UNITSITSTMTBODYSTree:%p.BEGINSECTBeginningsection+`%w'..DEFAULT.<<@<
 L3@+3:     ,nd2B5+3&      ,nd2B5+3* 
9+3,     ,nd3B5+3+ +3, 
93B+38 5       ,k2B+38 5        ,k3B+3:   B+3   B~650V+3?3@+3?  @8 ~ ,j< B~ 
~ L+3 ~,k B~  
~ L}650V+3I } +3I    B} D| F|651V+3N |+4l  B,u }  B! },tl 
5 L"  
} L{650V+3X { +3X  }  
9 B{ Dz Fz Hy650V+4Z650V+4Z650V+3r {   ,nd2B5+3g {    +3i {    
93D5 2B+3r { 
58+3r3@w+3t { 8 8 
5
2L8+3t 
y Lz 
9+3t 2B+4R 
y L 
{ L 
z L {   ,nd2B5+3 {    +4 {    {      {     By-4kN	R	4 {       DB {   ,nd2B5+4 {    +4 {   ,nd 5
,k3B+4  
{ L! y 82@8+4 
5 L"+4D y    ,j7 B"+4D {   ,nd2B5+4& {    +4( {   ,nd 5,k3B+46 y 8 
52L8+46 y 8 82@8+41 
5
 L"+4D y     ,j7 B"+4D y 8 
5
2L8+4= y     ,j7 B"+4D y 8 8 
5
2L8+4D y      ,j7 B"3@z+4J  Bz " 5	,j>  5	 5,sQ3@"+4N y 5,j>  5 5,s% y {,u-4kP 
y Lz y  By {  D{650V+4W +4X  B{ y By+3\3@+4]  },u B},u,u,u,u,u3@|+4d },jG | B8 |  B|+4f },jG B| B| }  D}650V+4j +4k  B}+3L B~  
~L}650V+4q } +4q    B} D| F|651V+4v |+53@|+4{  },jI | B8 |+4}  },jI B|,k B| }  D}650V+5 +5  B}+4t>x,~<<}<{<y<{<
<
X<	7<~%p is obsolete and non-portable to VAX/VMS FORTRAN.DECODEEDENCODEEDUNLOADEDREREADEDSKIPFILEDSKIPRECORDete BACKFILEPUNCHYPE<
B@<.<@<  ,nd2B89+5A x    +5C x   ,nd 89,k3B+5c x   ,nd2B89+5L x    +5N x   ,nd2B88+5Q 88+52B87+5S 87+52B86+5U 86+52B85+5W 85+52B84+5Y 84+52B83+5[ 83+52B82+5] 82+52B81+5 81+5   80,j>  80 8/,s%+8
 x   ,nd2B89+5l x    ,nd2B8/+5o 
9+5q x   ,nd3B8/+5p +5q 
93B+5s ,u+8
 x   ,nd2B89+5| x    ,nd2B8.+5 
9+6 x   ,nd3B8.+6 +6 
93B+6 
x L! ,u+8
 x   ,nd2B89+6.+6 
9+6 x   ,nd3B8.+6 +6 
93B+6 ,u+8
 x   ,nd2B89+6 x    +6 x   ,nd 8-,k3B+6/68$0V+6, 8-  ,k2B+6+ 8-   ,k2B+6+ 8-    ,k3B+6, 
9+6- 2B+8
 ,u+8
 x   ,nd2B89+68 x    ,nd2B8,+6; 
9+6= x   ,nd3B8,+6< +6= 
93B+6? ,u+8
 x   ,nd2B89+6H x    ,nd2B8,+6K 
9+6M x   ,nd3B8,+6L +6M 
93B+6O ,u+8
 x   ,nd2B89+6X x    ,nd2B8++6[ 
9+6] x   ,nd3B8++6\ +6] 
93B+6_ ,u+8
 x   ,nd2B89+6h x    ,nd2B8++6k 
9+6m x   ,nd3B8++6l +6m 
93B+6o ,u+8
 x   ,nd2B89+6x x    ,nd2B8*+6{ 
9+6} x   ,nd3B8*+6| +6} 
93B+6 ,u+8
 x   ,nd2B89+7 x    ,nd2B8*+7 
9+7   ,nd3B8*+7
 +7
93B+7 ,u+8
 x   ,nd2B89+7 x    ,nd2B8)+7 
9+7 x   ,nd3B8)+7 +7 
93B+7 ,u+8
 x   ,nd2B89+7( x    ,nd2B8)+7+ 
9+7- x   ,nd3B8)+7, +7- 
93B+7/ ,u+8
 x   ,nd2B89+78 x    ,nd2B8(+7; 
9+7= x   ,nd3B8(+7< +7= 
93B+7? ,u+8
 x   ,nd2B89+7H x    ,nd2B8(+7K 
9+7M x   ,nd3B8(+7L +7M 
93B+7O ,u+8
 x   ,nd2B89+7X x    ,nd2B8'+7[ 
9+7] x   ,nd3B8'+7\ +7] 
93B+7_ ,u+8
 x   ,nd2B89+7h x    ,nd2B8'+7k 
9+7m x   ,nd3B8'+7l +7m 
93B+7o ,u+8
 x   ,nd2B89+7x x    ,nd2B8&+7{ 
9+7} x   ,nd3B8&+7| +7} 
93B+7 ,u+8
 x   ,nd2B89+8 x    +8 x   ,nd 8&,k3B+8
 ,u ,u68$0V+8 8-  ,k2B+8 8-   ,k2B+8 8-    ,k3B+8 
9+8 3B+8 ,u 
68%0V+8" 
 
0 
02L8%+8" ,u+8# ,u >+u<<0<
2<-<)<<"<r<@<H<)<<*<*<+to `%w'.>	 Bx   B  B69Y0V+9X @~ @~ @} @} @| B}   B~69Y0V+8Q ~ ,j< B~   D+8J   B2B+8J3@~+9 ~  B| ~  D~ B  F~ ,jG   B| D{ F{2@|+8^ +9 |  Bz |  D|  Bz Dz   By Dy Dy  Bx3B+8h +8i 
92B+8l 
969Z1V+8l 3B+8{  Bx  Dy3B9^+8q +8r 
93B+8{3D+8w  Bx  Dy Bz 
9+8x 3B+8{ 
93D+8{ 3B+8\ 9^ z,kv2B+9 z,j7 By,j< ByZ$ y 
8"9ZbB9[n9[,jg3B+9 yZ"/,k2B+9Z&@@ y,jE  " z 9],j>  9] 9\,s% V z,j< BV 
9 9^ z,k 

9 L{+8\ {3B+8Q 

9 L}+8Q 
} L~ ~ 
9 B| D{ ~,jG   B{ Dz Fz2@{+9 +9U {  By {  D{  By Dy   Bx Dx Dx  Bw3B+9) +9* 
92B+9- 
969\1V+9- 3B+9<  Bw  Dx3B9^+92 +93 
93B+9<3D+98  Bw  Dx By 
9+99 3B+9< 
93D+9< 3B+9 9^ y,kv2B+9S y,j7 Bx,j< BxZ$ x 
8"9ZbB9[n9[,jg3B+9O xZ"/,k2B+9OZ&@@ x,jE  " y 9],j>  9] 9\,s% V y,j< BV 
9 9^ y,k 

9 Lz+9 z3B+9W 

9:L},} >w,~<<xx<w<
@9bV,loisBV,~<,GENDECLSTIdentifierswere0generatedandBdeclared byTRANSFORT+9| +9}   B~ D~6;(1V+: ~+: ~ 8 
;12L8+: ~ ~ ,k* B~   B6;(0V+:
 +:
  B~+9~,q' B  
 L~6;)0V+: ~ +:   B~ D}6;)1V+: }+:  ~ 8 
;12L8+: } ~ ,k* B} ~  B~6;(0V+: +:  B~+:,q' B~  
 L~6;)0V+:% ~ +:&   B} D}6;)1V+:* }+:4 } 8 
;02L8+:/ } } ,k* B} ~  B~6;(0V+:3 +:3  B}+:',q' B~  
 L}6;*0V+:: } +::   B} D|6;*1V+:> |+:I } 8 
;02L8+:C | } ,k* B| }  B}6;(0V+:G +:H  B}+:<,q' B}  
 L}6;*0V+:N } +:O   B| D|6;*1V+:S |+:] | 8 
;/2L8+:X | | ,k* B| }  B}6;(0V+:\ +:\  B|+:P,q' @|	 @|	 @| @| @| @| @| @| 
 } ~ ~  D| F| H{ J{ 
|Lx;1,u Bz | ;1,u Bz | ;0,u By { ;0,u By { ;/,u Bx ;/ a,j<@@,j| ;.,j| ;.,j< ;-,j| Bw ;/ a,j<@@,j| ;.,j| ;-,j< ;-,j| Bv ;/ a,j<@@,j| ;.,j| ;.,j< ;-,j| Bv ;/ a,j<@@,j| ;.,j| ;.,j< ;-,j| Bu ;/ a,j<@@,j| ;.,j| ;,,j< ;-,j| Bu ;/ a,j<@@,j| ;.,j| ;.,j< ;-,j|  u u,jf  x,jI  x,jI  y,jI  y,jI  z,jI  z,jI v,j| v,j| w,j| Bw ;, ;+ ;+,sP w x>t+u<<<<~<~<}<}<
B<@<.<@> Bx D3D+;`  B D6;a0V+;< +;<    B~ D~ F}6;b1V+;A ~+;S3@}+;H ~ ;e,jm  ;e,jm ,jI } B8 }+;M ~ ;e,jm  ;e,jm ,jI B~,k B}   D6;a0V+;R +;R  B~+;? B ;d >,j<@@,j| ;d,j| B~ 
x2L;c+;Z;c+;[ x,jG  ,jI  ~ ;b,jf>}+jG >},~<<<	6
DECFORCINCAGEDeclarations were forced into an INCLUDE fileNSFO<
|
<{<@> Bx D  
x L6=V0V+<  +<  
    B~ D~ F} J|  H}6=V1V+<3@}+< }+= += ! ~,jT3B+<  

9 L~3@|+<Q3@~+<5 a ~     ,jT3B+<5 

9 L}  D~ ~ 
=\3L8+<2 =[ ~    ,k3B+<2  ~,j<+<N ~,jG  ,jI+<N ~ 
=\3L8+<; =[ ~    ,k2B+<L ~ 
=\3L8+<M 
~ 
0 
0 
06=W0V+<M ~     B|6=W1V+<F +<G 
93B+<K | 3B=Z+<K +<K 
93B+<M  B~ ~,jG ,jI | B8 |+=3@~+<e a ~     ,jT3B+<e 

9 L}  D~ ~ 
=\3L8+<b =[ ~    ,k3B+<b  ~,j<+<~ ~,jG  ,jI+<~ ~ 
=\3L8+<k =[ ~    ,k2B+<| ~ 
=\3L8+<} 
~ 
0 
0 
06=W0V+<} ~     B|6=W1V+<v +<w 
93B+<{ | 3B=Z+<{ +<{ 
93B+<}  B~ ~,jG ,jI B},k B|   D6=X0V+= +=  B~+<2B+=U  
x L6=V0V+=
  +=
    B~ D~ F}6=V1V+= ~+=R3@}+=0 ! ~,jT3B+=,  B} 
 L}6=X0V+= } +=  ~      B| D|6=X1V+=! +=* | 8 8 8 8 
| L8 }  B}6=W0V+=( +=)  B|+=  ~,j<+=- ~,jG ,jI } B8 }+=L ! ~,jT3B+=I  B} 
 L}6=X0V+=7 } +=8  ~      B| D|6=X1V+=> +=G | 8 8 8 8 
|L8 }  B}6=W0V+=F +=F  B|+=<  ~,j<+=J ~,jG ,jI B~,k B}   D6=X0V+=Q +=Q  B~+= B =Z =Y =Y,s% >{,~<<0<<<}<
	7<	F<@<<@<<@<<@<<@<2<@<<@<
<@<3<@<	i<@<	i<@<	R<@<.<@<	2<@<	4<@<<@<	h<@
D20FOR$INTRINSIC-LISTSYM
D20FOR$CONSTANT-EXPRESSIONL' IMPLICITTYPENTNONED20FOR$IMPLICIT-CLASS-NO-ERRORas bTYPEASSUMTYPUNKNWN
D20FOR$SET-TYPE-OF-VARreD20FOR$SET-TYPE-OF-VAR-EXPLICITno D20FOR$GAFS-LISTF-VFORTRANSYMBOL-D20FOR$CONST-EXPRMO
D20FOR$UNIMPLEMENTED-CONST in
D20FOR$BOGUS-CONST-OPERAND inD20FOR$UNIMPLEMENTED-CONST-OPSTRING2FLOATT
D20FOR$CRUNCH-SIMPLE-DCLS %pARGUMENTDINTERNALDPRINTFORTRANSYMBOLS
D20FOR$EXAMINE-TYPING1IN
D20FOR$CHECK-ASSIGN-TYPING ta
D20FOR$EXPR-MODE-TYPEINDOUBLE-COMPLEXD20FOR$ISF-OR-SARGS
D20FOR$CHECKPARAMETERS-FN typUNKNOWNED20FOR$EXPRVr 
D20FOR$DECLARE-DO-ITERATORqui
D20FOR$PROCESS-COMMON-BODYquiD20FOR$PROCESS-DATA-BODY
D20FOR$ADD-TO-ARG-LISTIOD20FOR$FUNCTION-ARG-LIST
D20FOR$CHECKPARAMETERSTD20FOR$TEST-IF-VARIABLEVARUSED2M
D20FOR$TEST-IF-VARIABLE-FNNID20FOR$TEST-PARAM-FOR-COMMON-FNlenEXPODEXPCEXPALOGDLOGCLOGALOG10NTDLOG10NTSQRTDSQRTNTCSQRTNTSINLSINDDSINCSINCOSLCOSDDCOSCCOSTANLDTANCOTANNTDCOTANNTASINDASINNTACOSDACOSNTATANDATANNTATAN2NTDATAN2NTSINHDSINHNTCOSHDCOSHNTTANHDTANHNTIABSDABSCABSAINTINTEIDINTRNTDIINTRNTANINTNTDNINTNTNINTIDNINTNTAMODDMODAMAX0NTAMAX1NTMAX0MAX1DMAX1RNTAMIN0NTAMIN1NTMIN0MIN1DMIN1RNTISIGNNTDSIGNNTDIMLIDIMDDIMDPRODNTCONJGNTAIMAGXNTCMPLXXNTDFLOATNTDBLESNGLIFIXICHARRNTLENAINDEXRRLGEGLGTCLLECLLTC>  
C Lx6?R0V+?B x +?C  B6?R1V+?F +?Q  ,tt    D 
?S L 
?SLxBx6?R0V+?O&+?PBDB+?C>,~<x<<*<~< D2D@!+?c,u +@ 
@!2L+?eZ, L~  
@ 2L8+?k @     ,u% B~   B3@+@  
@3L8+@ @  ,k3B+?t   D+?l  8 
@2L8+?l @   ,k3B+@ ~  ,j<  @    ,k   B+?l  8 
@2L8+?l?,j1B~?,j1  ~ B} D} } },jg2B+@ },j2 B| ~  ,j<  @ |,k },ji B}+@
<5> @6,j1 Bx @5,j1  x B D  ,jg3B+@+ +@4 ,j2   D~ @5 ~,kv 3F+@2 @5 ~,lo ,ji B+@'>~,~<4<-< <+

@

<@<$<@
@
-<@+@X,uc@X+ud"p:l".d",j2:@a+kv<<4%wAssumedGE<<
,,tu  A,j>  A A,s% ,j4 A,k3B+A A+A A
 A
,s%>~,~<<<62@+A 
 L2@+A x,tt   D8   B8+A >~,~> Dx F H,tt 
x L 
 L 
 L >~,~,>,j7Z$ 
"A0bBA0nA1:,jg2B+A+ x+A/ x,j7Z&@@,jE>+l	>,~x>   D6AG0V+A6   ,tu B AH,kv  Dx3D+A< +AF G ,j< BG 
    ,k? ,j| AH,j|,k?  Fx AH ,k x>,~<<8>  
G Lx6A\0V+AN x +AN  B6A\1V+AR  BG+A[ A] ,kv3B+AV A] ,lo x  Bx6A]0V+AZ +AZ  B+AO>,~<x<<8> Bx    B D F~ x 8 
B2L8+Ag x  +Ah x  B 
6B0V+Am  8 
B3L8+An +A  ,tt B  ,tt B~  
B L8 2@8+Ax   D8   F8     ,u%  B8      D+Ah>~,~<0<
<	aCHOLLERITHaconstantESia<LOGICAL.constantOansOCTALeconstantO<ving%w.w.<
x2LBM+B1  BL,k-3B+BF BL ~,j>  BK BK,s%+BF BJ x,k3B+BF ~ BJ,k3B+B: BI ,j>  BK BK,s%+BF ~ BM,k3B+B@ BI ,j>  BK BK,s%+BF ~ BH,k3B+BF BH ,j>  BK BK,s% >},~
<
B
6
1%pMS!<
9<@<
7<@<
6<@<
7<@<
8<@<
8<@<@>	 Bx D,jG  B D~2@+Bg +F\     D @| 
    B~ D} F} H| J| 
| L{   Dz D{  Bz3B+Bt +Bu 
92B+Bx 
96F^1V+Bx 3B+C.   Dz3BF~+B} +B} 
93B+C.6F^0V+C*  Bz  Dz   Bz Dy Dz  By3B+C +C 
92B+C 
96F_1V+C 3B+C+  By  Dy3BF}+C +C 
93B+C+6F^0V+C'  By  Dy   By Dx Dy  Bx3B+C +C 
92B+C 
96F_1V+C 3B+C(3D+C$  Bx  Dx B} 
9+C% 3B+C( 
93D+C( 3B+C+ 
93@y+C+ 3B+C. 
93@z+C. 3B+Cu6F`0V+C2 } +C2 } B{2BF}+C9  F|,j< B }  Z",t} Bz+Ct2BF|+C@  F{,j< B }  Z",t} Bz+Ct2BF{+CF  Fz,j< B }  Z",t} Bz+Ct2BFz+CM  Fy,j< B }   Fy,t} Bz+Ct2BFx+CS  Fx,j< B }   Fy,t} Bz+Ct2BFw+CX  Fw,j< B }  +Ct2BFv+Cd }  ,tt Bz 
Fv2L+Ca  ,j< B z  Bz+Ct }  ,u*+Ct2BFu+Ch  Fu,j< B@@ Bz+Ct2BFt+Cm  Ft,j< B Fs Bz+Ct2BFs+Cq  Ft,j< B@@ Bz+Ct } Fr,j>,u+@@ B~+Be ~  B{ Dz D{  Bz3B+Cz +C{ 
92B+C~ 
96F^1V+C~ 3B+DR  Bz  Dz3BF~+D +D 
93B+DR6F^0V+DO  Bz  Dz   Bz Dy Dz  By3B+D +D 
92B+D 
96F_1V+D 3B+DO  By  Dy3BF}+D +D 
93B+DO6F^0V+D-  By  Dy   By Dx Dy  Bx3B+D! +D" 
92B+D% 
96F_1V+D% 3B+D.  Bx  Dx3BFr+D* +D+ 
93B+D. 
93D+D. 3B+DO3@y+D4 y  By y  Dy B} 
9+D5 3B+DO6F`0V+DL y  By y  Dy   By Dx Dy  Bx3B+D@ +D@ 
92B+DD 
96F_1V+DD 3B+DL  Bx  Dx3BFq+DI +DI 
93B+DL 
93D+DL 3B+DO 
93@y+DO 3B+DR 
93@z+DR 3B+DV  },Ba B{ B~+Be ~  B{ Dz D{  Bz3B+D\ +D\ 
92B+D` 
96F^1V+D` 3B+EM  Bz  Dz3BF~+De +De 
93B+EM ,jG Bz3@z+E 
z6Fa0V+E z   By Dy Dy  Bx3B+Dq +Dq 
92B+Du 
96Fa1V+Du 3B+E  Bx  Dy3BF}+Dz +Dz 
93B+E6F^0V+E  Bx  Dy   Bx Dx Dx  Bw3B+E +E 
92B+E 
96Fb1V+E 3B+E3D+E
  Dx 
9+E3B+E 
93D+E 3B+E 
93@y+E 3B+E z  B{ 
9+E z  By z  Dz  z,jG Bz+Dh3B+EM6Fb0V+EJ z  Bz z  Dz   Bz Dy Dz  By3B+E' +E' 
92B+E+ 
96F_1V+E+ 3B+EJ  By  Dy3BF}+E0 +E0 
93B+EJ6F^0V+EG  By  Dy   By Dx Dy  Bx3B+E: +E; 
92B+E> 
96F_1V+E> 3B+EG3D+ED  Bx  Dx B} 
9+ED 3B+EG 
93D+EG 3B+EJ 
93@y+EJ 3B+EM 
93@z+EM 3B+En  B{ 
{ L{6Fc0V+ES { +ET  Bz },jG  F},jm  F~,jm ,Ba  z Bz Dy6Fc0V+E^2@y+E_ y+Em Fq z,jT3B+Ec y,jz By+Eg Fq z,jT3B+Eg y,kG By {  B{6Fc0V+Ek +El  Bz+E[ B~+Be ~  B{ Dz D{  Bz3B+Es +Et 
92B+Ew 
96F^1V+Ew 3B+F  Bz  Dz3BFp+E| +E} 
93B+F3D+F  Bz  Dz B| 
9+F 3B+F3D+F  Bz  Dz B} 
9+F	 3B+F3D+F  Bz  Dz B| 
9+F 3B+F 
93D+F 3B+Be  |,Ba B{  |,Ba  { Bz Dz6Fc1v+F1V+F@@z6F^1v+F1V+F@@z }    By2BFp+F# Fp,u++F[2BFo+F& Fo,u++F[2BFo+F) z z,jj+F[2BFn+F, z z,jh+F[2BFn+F/ z z,ji+F[2BFm+F2 z z,jj+F[2BFm+F4 Fm,u++F[2BFl+F7 Fl,u++F[2BFl+F9 Fl,u++F[2BFk+F< Fk,u++F[2BFk+F> Fk,u++F[2BFj+FA Fj,u++F[2BFj+FC Fj,u++F[ Fi,k3B+FG Fi,u++F[ Fh y,k3B+FK Fh,u++F[ Fg y,k3B+FO Fg,u++F[ Ff y,k3B+FS Ff,u++F[ Fe y,k3B+FW Fe,u++F[ Fd y,k3B+F[ Fd,u++F[  B~+Be ~>w,~<z<<y<x<}<y<0<x<w<z<{<<
9
7
6
7
8
8
:<
;<
;<
:<
9<
1<
5<<<<</<
5<
3<
\
B<
[<<
<
<.<
<<
<
<
<<
<<
<
4<
2UNIMPCNOPConstant expression operator %p not implemented.  G,j>  G G
,s%@@,~<lConstant expression operand %p not implemented.  G,j>  G G,s%@@,~<l
BUGCHECKSInternalDError#4-OGG",j>GG!G!+s%<
$GEbDGFnGF@@B~D~~@~,jg3B+G1 +GD x ,ji B} ~ d"p:l" d" B} GG x,k3B+G:Z"+G;@@  },jh  },jj B ~,ji B~+G-6GE0V+GC >|+u, >|,~<x
H> L|@@|@@  @@ B D F~ H~ J} 
| L} 
| L|@@d"p:l" d" B| H=,k3B+Gj 
9 
|1L+Gd  D~ ,ji  D d"p:l" d" B| |,q2B+Gm +GyZ$ },ji B{Z$ |,jh  {,jj B} ,ji  D d"p:l" d" B|+Gj 
|0L+H ,ji  D d"p:l" d" B| |,q2B+H +HZ$ },ji B{Z$ |,jh  {,jj B} H= |,ji B| ,ji  D d"p:l" d" B|+H | },jj B} H< |,k3B+H3 ,ji  D d"p:l" d" B| H=,k3B+H% 
9 
|1L+H>D~B,ji  D d"p:l" d" B| |,q2B+H( +H3Z$ },ji B{Z$ |,jh  {,jj B} ,ji  D d"p:l" d" B|+H%3@~+H6 },jz B}3@~+H8 },jz B} } H=,je  },ji>{+kH
Hk3L8+Hf  
Hk2L8+HJ  +HJ  Z" B D6Hh0V+Hb  B~6Hh1V+HQ +HR 
93B+HV ~ 3BHj+HV +HV 
93B+Hb x 
Hj2L8+H]Hi,jT3B+H]Z"+H`Hi>BD ,u% B   D  x ,jm  >~+u, >~,~<<<
     B D~ F~ H} J}2@}+Hx +J }    B~ }  D}  B|6J1V+H +I 
93B+I | 3BJ
+I +I 
93B+I( 
J
2L+I } 
J	3L8+I J	 } ,k2B+I } } ,j< B} }  B}+I },k B} }  D}6J0V+IF  B|6J1V+I +I 
93B+I | 3BJ+I +I 
93B+IF  8 
J
3L8+I% J }   ,u% B~+I& 
J L~ }  B}+IF6J0V+I8  B|6J1V+I- +I- 
93B+I2 | 3BJ+I1 +I2 
93B+I8 J }   ,u% B~ }  D} 
J
2L+IF } 
J	3L8+IC J	 } ,k2B+IA } } ,j< B} }  B}+I9 },k B} }  D} } B|6J1V+II +IJ 
93B+IN | 3BJ+IN +IN 
93B+IQ }  D} ~ B,tt B~3@+Ik  B|6J1V+IW +IX 
93B+I\ | 3BJ+I\ +I\ 
93B+I_ ~ 
J L8+Ir   ~ D83@~+Id ~ 
~ L8+Ig    ~ F8 ~ 
J3L8+Ir ~ 
J L8+Ir ,tt B| ~2@8+Io  ~ D8 ~2@8+Ir  ~ D83@}+I{ ~ 
J2L8+Iw ~ 
J L8+Iy ~ 
J L8 ~ 
} L8+I~ ~2@8+I~ ~ 
J L8  B|   D~ B~ | B}+Hv>|,~<<<	<
<<<<<<"<<%p%nSS	6StorageClass4%p%n Dimensions%p%nS1VClass%p%nYM  Size %p%nSYM  Type %p%nSYM%p:%nGAF> Bx,tt B x J-,kW   J,,kW   J,,kW   J+,kW   J+,kW   J*,kW   J*>+kW
3LJD+J< ,tt B~ 
JDL>B6JC0V+J@+JAB6B+J6>~,~<<<*<<Jg1V+JR +Je 
3LJi+J` Jh  ,k3B+JY    D+JZ   ,tt B~ 
Jh L 
Jg2L+J`UCDnFar6B6Jf0V+Jdt+Jd%dB+JO>~,~<<<*< subscript of type %p to array %p was found.<
TARRFNSIdentifier %weisunotrangarraywordfunction%w<	TVARMESIdentifier %w cannot be the target of an assignment<<
<@<

<@<
<@> Bx,jG  B D2@+K0 +O"     D 
    B~ D~ F} H} J|   D{ D|  B{3B+K< +K< 
92B+K@ 
96O$1V+K@ 3B+Kk6O$0V+K\  B{  D{   B{ Dz D{  Bz3B+KJ +KJ 
92B+KN 
96O%1V+KN 3B+K\  Bz  Dz3BO5+KS +KS 
93B+K\3D+KY  Bz  Dz B~ 
9+KY 3B+K\ 
93D+K\ 3B+Kk {  {  D{3BO4+Kb +Kb 
93B+Kk3D+Kh  B{  D{ B} 
9+Kh 3B+Kk 
93D+Kk 3B+L ~,tt B|2@+Ks ~,tt B{  | D8  | F8 |2@8+Kw | 
O4 L8+K~ O3 | ,k2B+K~ ~,tu  O3,j>  O2 O2,s%  }  ,u.  | ,u/+K. ~  B| D{ D|  B{3B+L	 +L	 
92B+L
96O$1V+L6O$0V+L)  B{  D{   B{ Dz D{  Bz3B+L +L 
92B+L 
96O%1V+L 3B+L)  Bz  Dz3BO5+L  +L  
93B+L)3D+L&  Bz  Dz B~ 
9+L& 3B+L) 
93D+L) 3B+Lf {  B{ {  D{3BO1+L/ +L0 
93B+Lf ,jG B{3@{+L5 
{ 
02LO1+L8 {  B} 
9+L= {  Bz {  D{  {,jG B{+L23B+Lf {  B{ {  D{3BO1+LC +LD 
93B+Lf ,jG B{3@{+LI 
{ 
02LO1+LL {  B| 
9+LQ {  Bz {  D{  {,jG B{+LF3B+Lf {  B{ {  D{3BO1+LW +LX 
93B+Lf  B{  D{3BO4+L] +L] 
93B+Lf3D+Lc  B{  D{ B} 
9+Lc 3B+Lf 
93D+Lf 3B+M; ~,tt   B| D{2@+Lp ~,tt B{  { D8  { F8 { 
O03L8+Lw ~,tu  {  O0,j>  O/ O2,s% O/ { ,k3B+L ~,tu  O.,j>  O. O2,s%  B{ 
} L{6O$0V+M { +M  Bz6O$0V+M O- z,k2B+M  z  ,u. B| O-,k2B+M O, |,k2B+M ~,tu  | O,,j>  O+ O+,s% {  B{6O%0V+M +M  Bz+M  B{ 
| L{6O$0V+M  { +M   Bz6O$0V+M6 
z3LO*+M0  z  ,u. B| O-,k2B+M0 O, |,k2B+M0 ~,tu  | O*,j>  O) O+,s% {  B{6O%0V+M4 +M5  Bz+M!  }  ,u.  { ,u/+K. ~  B| D{ D|  B{3B+M@ +MA 
92B+MD 
96O$1V+MD 3B+N
6O$0V+M`  B{  D{   B{ Dz D{  Bz3B+MN +MO 
92B+MR 
96O%1V+MR 3B+Ma  Bz  Dz3BO5+MW +MX 
93B+Ma3D+M]  Bz  Dz B~ 
9+M^ 3B+Ma 
93D+Ma 3B+N
 {  B{ {  D{3BO1+Mg +Mg 
93B+N
 ,jG B{3@{+Mm 
{ 
02LO1+Mo {  B} 
9+Mu {  Bz {  D{  {,jG B{+Mj3B+N
 {  B{ {  D{3BO1+M{ +M{ 
93B+N
  B{  D{3BO4+N +N 
93B+N
3D+N  B{  D{ B} 
9+N 3B+N
 
93D+N
 3B+O } O1,k2B+K. ~,tt   B| D{2@+N ~,tt B{  { D8  { F8 } O*,k2B+N  O/ { ,k3B+N  ~,tu  O.,j>  O. O2,s% } O*,k3B+N5 {2@8+N& { 
O4 L8+N- O) { ,k2B+N- ~,tu  O3,j>  O2 O2,s% { 
O03L8+N5 ~,tu  {  O0,j>  O/ O2,s% {2@8+N\ O) { ,k2B+N\ } O*,k2B+N\ { 
O( L8  B{ 
} L{6O$0V+NB { +NC    Bz Dz Fy6O$1V+NH z+NY 
z3LO(+NS3@y+NP z  ,jG,jG y B8 y  By+NS z  ,jG,jG By Bz {  B{6O%0V+NW +NX  Bz+NE { B8 { 
} L8+K. } O*,k3B+N~  B{ 
} L{6O$0V+Nc { +Nd  Bz6O$0V+Ny 
z3LO*+Nt  z  ,u. B| O-,k2B+Nt O, |,k2B+Nt ~,tu  | O',j>  O) O+,s% {  B{6O%0V+Nx +Nx  Bz+Nd  }  ,u.  { ,u/+K.  B{ 
} L{6O$0V+O { +O  Bz6O$0V+O 
z3LO(+Oz ,u. B| O-,k2B+O O, |,k2B+O ~,tu  | O,,j>  O+ O+,s% {  B{6O%0V+O +O  Bz+O  }  ,u.  { ,u/+K.  D O' O& O&,s% B+K. >y,~<{<<z<<
mFN a+u.<character operands.typeBADARTHOPA numeric operator was used on logical operands.f<
BBADLOGOPSA logical operator was used on numeric operands.f<
9
5<@BADRELOPS A relational operator was used between operands of type %p and %p.<

8
BUGCHECKSInternal Error #3aOCTCNSTESAn octal constant was found in an expressionHOLCNSARG!A hollerith constant was used as an actual argument to function %p.CHRCNSARG!A character constant was used as an actual argument to function %p.NONNUMSUBA non-numeric subscript of type %p to array %p was found.fo<

<
<@<?<@<
B<@<
:

8
<@<	
;.<@<
6
<<@<
;
7

:<@<
9<@<
<@<
7
6<@>
 Bx D,jG  B D~2@+P* +X.     D @| @| 
    B~ D} F} H| J| 
| L{ 
| L{   Dz Dz  By3B+P9 +P9 
92B+P= 
96X/1V+P= 3B+QV   Dz3BXS+PA +PB 
93B+QV ,jG By3@z+Q 
z6X00V+Q z   By Dx Dy  Bx3B+PM +PN 
92B+PQ 
96X01V+PQ 3B+Q  Bx  Dx3BXS+PV +PW 
93B+Q6X10V+Q  Bx  Dx   Bx Dw Dx  Bw3B+Pa +Pa 
92B+Pe 
96X11V+Pe 3B+Q6X10V+P  Bw  Dw   Bw Dv Dw  Bv3B+Po +Po 
92B+Ps 
96X21V+Ps 3B+Q  Bv  Dv3BXR+Px +Px 
93B+Q3D+P|  Dv 
9+P} 3B+Q 
93D+Q 3B+Q 
93@w+Q 3B+Q 
93@x+Q 3B+Q	 y  B{ 
9+Q z  z  Dz  y,jG By+PD3B+QV6X20V+QS z  By z  Dz   By Dy Dy  Bx3B+Q +Q 
92B+Q 
96X31V+Q 3B+QS  Bx  Dy3BXS+Q" +Q# 
93B+QS6X10V+QP  Bx  Dy   Bx Dx Dx  Bw3B+Q- +Q- 
92B+Q1 
96X31V+Q1 3B+QP6X10V+QM  Bw  Dx   Bw Dw Dw  Bv3B+Q; +Q; 
92B+Q? 
96X41V+Q? 3B+QM  Bv  Dw3BXR+QD +QD 
93B+QM3D+QJ  Bv  Dw B} 
9+QJ 3B+QM 
93D+QM 3B+QP 
93@x+QP 3B+QS 
93@y+QS 3B+QV 
93@z+QV 3B+Qu },tt    Bz Dz Fy XR ,k3B+Qe y2@8+Qm },tt By  y D8  y F8 y +Qt y2@8+Qk },u0 y 
XQ L8 },tt Bz+Qp y3@8+Qo+Qs y +Qt },tt By  y D8  y F8 y  B~+P( ~  Bz Dz Dz  By3B+Q{ +Q{ 
92B+Q 
96X/1V+Q 3B+SH  By  Dz3BXS+R +R 
93B+SH ,jG By3@z+R] 
z6X00V+R\ z   By Dx Dy  Bx3B+R +R 
92B+R 
96X01V+R 3B+R\  Bx  Dx3BXS+R +R 
93B+R\6X10V+RY  Bx  Dx   Bx Dw Dx  Bw3B+R# +R$ 
92B+R' 
96X11V+R' 3B+RY6X10V+RB  Bw  Dw   Bw Dv Dw  Bv3B+R1 +R2 
92B+R5 
96X21V+R5 3B+RB  Bv  Dv3BXR+R: +R; 
93B+RB3D+R?  Dv 
9+R? 3B+RB 
93D+RB 3B+RY w  Bw w  Dw3BXQ+RH +RI 
93B+RY3@w+RM 
w 
02LXP+RN 
9+RP w  Bw+RJ3B+RY w  Bw w  Dw3BXP+RV +RV 
93B+RY 
93D+RY 3B+R\ 
93@x+R\ 3B+R` y  B{ 
9+Re z  By z  Dz  y,jG By+R3B+SH6X20V+SD z  By z  Dz   By Dy Dy  Bx3B+Rp +Rq 
92B+Rt 
96X31V+Rt 3B+SE  Bx  Dy3BXS+Ry +Rz 
93B+SE6X10V+SA  Bx  Dy   Bx Dx Dx  Bw3B+S +S 
92B+S 
96X31V+S 3B+SB6X10V+S$  Bw  Dx   Bw Dw Dw  Bv3B+S +S 
92B+S 
96X41V+S 3B+S$  Bv  Dw3BXR+S +S 
93B+S$3D+S!  Bv  Dw B} 
9+S! 3B+S$ 
93D+S$ 3B+SB x  Bw x  Dx3BXQ+S* +S+ 
93B+SB ,jG Bw3@x+S0 
x 
02LXP+S3 w  B{ 
9+S8 x  Bw x  Dx  w,jG Bw+S-3B+SB x  Bw x  Dx3BXP+S> +S? 
93B+SB 
93D+SB 3B+SE 
93@y+SE 3B+SH 
93@z+SH 3B+T; },tt    Bz Dz Fy XP ,k3B+Sr  By 
{ Ly6X40V+ST y +SU  Bx6X41V+SX +Sj 
x3LXO+Se  x  ,P$ Bz XO,k2B+Se XN z,k2B+Se } z XN,j>  XM XM,s% y  By6X50V+Si +Si  Bx+SU y2@8+Sp },tt By  y D8  y F8 
y 
0 Lz+T8 y 
XL2L8+T
 { y  By Dx2@y+Sy +T x 
XO2L8+S} x  Bx+Sw y 8 
x 
0 
0 
0 L8 x  Bx y  Dy+Sw y  y ,k Bz   ,P$ Bz+T8 y2@8+T },tt By  y D8  y F8 
y 
0 Lz y 
XL3L8+T y 
XL L8 } {,u1  By 
{ Ly6X40V+T y +T    Bx Dx Fw6X41V+T! +T8 
x3LXO+T3  x  ,P$ Bz2@w+T,2BXK+T, 

9 Lw } XK,j>  XJ XM,s%+T32@x+T32BXJ+T3 

9 Lx } XI,j>  XI XM,s% y  By6X50V+T7 +T7  Bx+T N z,k* z B~+P( ~  Bz Dz Dz  By3B+TA +TA 
92B+TE 
96X/1V+TE 3B+U2  By  Dz3BXS+TJ +TJ 
93B+U2 ,jG By3@z+Ty 
z6X00V+Tw z   By Dx Dy  Bx3B+TV +TV 
92B+TZ 
96X01V+TZ 3B+Tx  Bx  Dx3BXS+T_ +T_ 
93B+Tx6X10V+Tt  Bx  Dx   Bx Dw Dx  Bw3B+Ti +Tj 
92B+Tm 
96X11V+Tm 3B+Tu3D+Tq  Dw 
9+Tr 3B+Tu 
93D+Tu 3B+Tx 
93@x+Tx 3B+T{ y  B{ 
9+U z  By z  Dz  y,jG By+TM3B+U26X20V+U/ z  By z  Dz   By Dy Dy  Bx3B+U
 +U
 
92B+U 
96X31V+U 3B+U/  Bx  Dy3BXS+U +U 
93B+U/6X10V+U,  Bx  Dy   Bx Dx Dx  Bw3B+U +U  
92B+U# 
96X31V+U# 3B+U,3D+U)  Bw  Dx B} 
9+U) 3B+U, 
93D+U, 3B+U/ 
93@y+U/ 3B+U2 
93@z+U2 3B+U_  Bz6X50V+U7 } +U8 } Bz2BXH+U> XH XG XM,s% }  Bz XG+U]2BXJ+UA }  Dz XF+U]2BXF+UE }  Dz XE+U]2BXE+UH }  Dz XD+U]2BXD+UL }  Dz XC+U]2BXC+UO }  Dz XB+U]2BXK+US }  Dz XB+U]2BXA+UV 
XA Lz X@+U]2BX@+UY 
XA Lz X@+U] 
X? Lz X?,j>  X> X>,s% N,k* z B~+P( ~  Bz Dz Dz  By3B+Ue +Ue 
92B+Ui 
96X/1V+Ui 3B+W  By  Dz3BXS+Un +Un 
93B+W ,jG By3@z+V: 
z6X00V+V9 z   By Dx Dy  Bx3B+Uz +Uz 
92B+U~ 
96X01V+U~ 3B+V9  Bx  Dx3BXS+V +V 
93B+V96X10V+V  Bx  Dx   Bx Dw Dx  Bw3B+V
92B+V 
96X11V+V 3B+V  Bw  Dw3BXQ+V +V 
93B+V 
93D+V 3B+V93@x+V x  Bx 
9+V 3B+V96X30V+V6 x  Bx x  Dx   Bx Dw Dx  Bw3B+V* +V* 
92B+V. 
96X11V+V. 3B+V6  Bw  Dw3BXP+V3 +V3 
93B+V6 
93D+V6 3B+V9 
93@x+V9 3B+V= y  B{ 
9+VB z  By z  Dz  y,jG By+Uq3B+W6X20V+W z  By z  Dz   By Dy Dy  Bx3B+VM +VN 
92B+VQ 
96X31V+VQ 3B+W  Bx  Dy3BXS+VV +VW 
93B+W6X10V+Vm  Bx  Dy   Bx Dx Dx  Bw3B+Va +Va 
92B+Ve 
96X31V+Ve 3B+Vm  Bw  Dx3BXQ+Vj +Vj 
93B+Vm 
93D+Vm 3B+W3@y+Vt y  Bx y  Dy B} 
9+Vt 3B+W6X40V+W y  Bx y  Dy   Bx Dx Dx  Bw3B+V +W 
92B+W 
96X31V+W 3B+W
  Bw  Dx3BXP+W +W	 
93B+W
 
93D+W
 3B+W 
93@y+W 3B+W 
93@z+W 3B+W  },P$ B~+P( ~  Bz Dz Dz  By3B+W +W 
92B+W 
96X/1V+W 3B+Wb  By  Dz3BX=+W$ +W$ 
93B+Wb3D+W*  By  Dz B| 
9+W* 3B+Wb6X10V+WW  By  Dz   By Dy Dy  Bx3B+W4 +W5 
92B+W8 
96X31V+W8 3B+WX  Bx  Dy3BX=+W= +W> 
93B+WX6X10V+WT  Bx  Dy   Bx Dx Dx  Bw3B+WH +WH 
92B+WL 
96X31V+WL 3B+WU3D+WQ  Bw  Dx B} 
9+WR 3B+WU 
93D+WU 3B+WX 
93@y+WX 3B+Wb3@z+W^ z  By z  Dz B| 
9+W_ 3B+Wb 
93@z+Wb 3B+P(   Bz Dz  |,P$ Bz  |,P$ Bz X< },k3B+W X< z,k3B+Ws XO z,k2B+Wz XN z,k2B+Wz X< z,k3B+W~ XO z,k2B+Wz XN z,k3B+W~ z z X;,j>  X; XM,s% X@+X- X: },k3B+X XB+X- X: },k3B+X XO z,k2B+X XN z,k2B+X XO z,k2B+X XN z,k3B+X X9 X9 XM,s% X@+X- X8 z,k2B+X X8 z,k3B+X X8 X7 XM,s% X< z,k2B+X X< z,k3B+X  X7 X7 XM,s% X6 z,k2B+X% X6 z,k3B+X& XB+X- X6 z,k2B+X+ X6 z,k3B+X, XD+X- XE B~+P( ~>u,~<y<0<x<<w<v<z<x<w<v<y<<}
2<
3<l
\<
B<
B<
[<.<<
<<
<<
<
<<


<~<<
<
4<
2BUGCHECKSInternal Error #7s A logical value was assigned to a character variable.eA numeric value was assigned to a character variable.eA character value was assigned to a logical variable.eA numeric value was assigned to a logical variable..eA character value was assigned to a numeric variable.e<
A logical value was assigned to a numeric variable.ble<
BA hollerith constant was assigned to a numeric variable.p aBITHACKASAn octal constant was assigned to a numeric variable.e<


B<@<
.<@<

<@<
<@,>,> YZ,k2B+Y YZ x,k3B+Y0 
2LYY+Y" YY YX YX+YO 
2LYW+Y& YW YX YX+YO YV ,k3B+Y* YV YX YX+YO YU ,k3B+Y/ YU YX YX+YO +YP YV x,k3B+Y? YZ ,k2B+Y7 YZ ,k3B+Y9 YT YX YX+YO YU ,k3B+Y> YT YX YX+YO +YP YU x,k3B+YN YZ ,k2B+YF YZ ,k3B+YH YS YX YX+YO YV ,k3B+YM YS YX YX+YO +YP YR YR YQ>+s%>,~<
<

> Bx   B  B6ZD0V+ZB @~ @~ @} @} B~ 
9 B| ~,jG   B| D{ F{2@|+Yi +Z	 |  Bz |  D|  Bz Dz   By Dy Dy  Bx3B+Ys +Yt 
92B+Yw 
96ZD1V+Yw 3B+Z  Bx  Dy P,k3B+Z3@y+Z y  Bx y  Dy Bz 
9+Z 3B+Z 
93@y+Z 3B+Yg  z,tw 

9 L{+Yg {3B+Z
 

9 L}   B~,jG   B| D| F{2@|+Z +Z2 |  B{ |  D|  B{ Dz   Bz Dy Dz  By3B+Z +Z 
92B+Z  
96ZE1V+Z  3B+Z.  By  Dy P,k3B+Z.3@y+Z+ y  By y  Dy Bz 
9+Z+ 3B+Z. 
93@y+Z. 3B+Z  {,tw 

9 L|+Z |3B+Z5 

9 L}6ZE0V+Z: ~ ,j< B~   D+Z
   B2B+Z
3@~+ZB ~  B| ~  D~ B+Z: } >x,~<<x<y<~An character variable was equivalenced to a logical variable. %pAn character variable was equivalenced to a numeric variable. %p<
BITHACKEQAn logical variable was equivalenced to a numeric variable.<
B


B<@<
.<@<

<@<
<@> Bx  B x    B D~3@~+Z{ ~ B~6[m1V+Zu +Zu 
93B+Zz ~ 3B[t+Zy +Zz 
93B+Z| +[ ~    D ~  F~ 
[t2L+[ ~ 
[t3L8+[ ~  B~+[ ~  B~ ~ B~6[m1V+[
 +[ 
93B+[ ~ 3B[s+[ +[ 
93B+[~D~x,j<qBD+ZpGBD~F~H}6[n1V+[+[lB~~~B}6[m0V+["|+["|B|6[n0V+[j	~,tt B~ |,tt B} ~2@8+[- ~,tt B|  ~ D8  ~ F8 }2@8+[3 |,tt B|  } D8  } F8 }  ~  B| D{ [s,k2B+[; [r |,k3B+[= [r {,k2B+[E [s {,k2B+[B [r {,k3B+[G [r |,k3B+[G [q [q [p,s%+[e [s |,k2B+[L [r |,k3B+[O [p {,k2B+[V [s {,k2B+[T [r {,k3B+[Y [p |,k3B+[Y [o [q [p,s%+[e [r |,k3B+[^ [p {,k2B+[c [r {,k3B+[e [p |,k3B+[e [o [q [p,s% }  B}6[m0V+[i +[i  B|+[#   B+[>{,~<<<}
92B+\
 
96\Z1V+\
 3B+\V   D|3B\^+\ +\ 
93B+\V3@|+\- 
|6\[0V+\, |   B| D{ D|  B{3B+\ +\ 
92B+\ 
96\[1V+\ 3B+\,  B{  D{3B\]+\$ +\% 
93B+\,3D+\)  D{ 
9+\) 3B+\, 
93D+\, 3B+\. 
9+\0 |  D|+\3B+\V6\\0V+\M |  B| |  D|   B| D{ D|  B{3B+\; +\< 
92B+\? 
96\[1V+\? 3B+\N  B{  D{3B\]+\D +\E 
93B+\N3D+\J  B{  D{ B~ 
9+\K 3B+\N 
93D+\N 3B+\V |  |  D|3B\]+\S +\T 
93B+\V D} 
93B+[| \\ ~,u(+[| >z,~<|<0<{<|<	<<
<r> Bx,jG  B D2@+\d +^	     D    B~ D~ F} H}   D| D|  B{3B+\o +\o 
92B+\s 
96^
1V+\s 3B+]   D|3B^+\w +\x 
93B+]   D|3B^+\| +\} 
93B+]3D+]  B{  D| B~ 
9+] 3B+]   D|3B^+] +] 
93B+] ,jG B{3@|+]
| 
02L^+] {  B} 
9+] |  |  D|  {,jG B{+]
3B+] |  |  D|3B^+] +] 
93B+] D} 
93B+]$ } ^,j< ^,j| ,j< B } ~,u3+\b ~  B| D| D|  B{3B+]) +]* 
92B+]- 
96^
1V+]- 3B+]F  B{  D|3B^+]2 +]3 
93B+]F  B{  D|3B^+]8 +]8 
93B+]F3D+]>  B{  D| B~ 
9+]> 3B+]F  B{  D|3B^+]C +]D 
93B+]F D} 
93B+]I } ~,u3+\b ~  B| D| D|  B{3B+]N +]O 
92B+]R 
96^
1V+]R 3B+]n  B{  D|3B^+]W +]X 
93B+]n ,jG B{3@|+]] 
| 
02L^+]` {  B} 
9+]e |  B{ |  D|  {,jG B{+]Z3B+]n |  B{ |  D|3B^+]k +]l 
93B+]n D} 
93B+]u } ^,j< ^,j| ,j< B } ,u3+\b ~  B| D| D|  B{3B+]z +]{ 
92B+]~ 
96^
1V+]~ 3B+^  B{  D|3B^+^ +^ 
93B+^ D} 
93B+\b } ,u3+\b >z,~<{<<"<"<@  ^ +u,
> Bx,jG  B D2@+^ +^M     D    B~ D~ F} H}   D| D|  B{3B+^  +^! 
92B+^$ 
96^O1V+^$ 3B+^J   D|3B^P+^) +^) 
93B+^J3D+^/  B{  D| B} 
9+^/ 3B+^J   D|3B^O+^4 +^4 
93B+^J ,jG B{3@|+^: 
| 
02L^O+^< {  B~ 
9+^A |  |  D|  {,jG B{+^73B+^J |  |  D|3B^O+^G +^G 
93B+^J 
93D+^J 3B+^ ~ },u3+^ >{,~<{<< ,~> Bx,jG  B D2@+^W +b6     D @| 
    B~ D~ F} H} J| 
| L|   D{ D{  Bz3B+^e +^e 
92B+^i 
96b71V+^i 3B+_A   D{3Bb=+^m +^n 
93B+_A6b80V+_
  Bz  D{   Bz Dz Dz  By3B+^x +^x 
92B+^| 
96b81V+^| 3B+_3D+_  By  Dz B| 
9+_ 3B+_3D+_  By  Dz B| 
9+_ 3B+_ 
93D+_ 3B+_A {  {  D{3Bb=+_ +_ 
93B+_A6b80V+_-  Bz  D{   Bz Dz Dz  By3B+_ +_ 
92B+_ 
96b81V+_ 3B+_-  By  Dz3Bb<+_$ +_$ 
93B+_-3D+_*  By  Dz B} 
9+_* 3B+_- 
93D+_- 3B+_A {  {  D{3Bb<+_3 +_3 
93B+_A3D+_9  Bz  D{ B~ 
9+_9 3B+_A   D{3Bb;+_> +_> 
93B+_A 
93D+_A 3B+_I 
|2Lb;+_I b: |,u%  b= b: },u( ~,u4+^U ~  B{ D{ D{  Bz3B+_O +_O 
92B+_S 
96b71V+_S 3B+_x  Bz  D{3Bb=+_X +_X 
93B+_x6b80V+_t  Bz  D{   Bz Dz Dz  By3B+_b +_c 
92B+_f 
96b81V+_f 3B+_u  By  Dz3Bb<+_k +_l 
93B+_u3D+_q  By  Dz B} 
9+_r 3B+_u 
93D+_u 3B+_x 
93@{+_x 3B+` ~ B{6b91V+_| +_} 
93B+` { 3Bb=+` +` 
93B+` b: },u(3@~+^U ~,u4+^U ~  B{ D{ D{  Bz3B+`
 +`
 
92B+` 
96b71V+` 3B+`5  Bz  D{3Bb9+` +` 
93B+`56b80V+`1  Bz  D{   Bz Dz Dz  By3B+` +`  
92B+`# 
96b81V+`# 3B+`2  By  Dz3Bb<+`( +`) 
93B+`23D+`.  By  Dz B} 
9+`/ 3B+`2 
93D+`2 3B+`5 
93@{+`5 3B+`C ~ B{6b91V+`9 +`: 
93B+`> { 3Bb=+`> +`> 
93B+`A b: },u(3@~+^U ~,u4+^U ~  B{ D{ D{  Bz3B+`I +`I 
92B+`M 
96b71V+`M 3B+a  Bz  D{3Bb=+`R +`R 
93B+a6b80V+`n  Bz  D{   Bz Dz Dz  By3B+`\ +`] 
92B+`` 
96b81V+`` 3B+`o  By  Dz3Bb<+`e +`f 
93B+`o3D+`k  By  Dz B} 
9+`l 3B+`o 
93D+`o 3B+a {  Bz {  D{3Bb<+`u +`u 
93B+a3D+`{  Bz  D{ B~ 
9+`{ 3B+a  Bz  D{3Bb;+a +a 
93B+a 
93D+a 3B+a ~ B{6b91V+a +a	 
93B+a3Bb=+a
93B+a b: },u(3@~+^U ~,u4+^U ~  B{ D{ D{  Bz3B+a +a 
92B+a 
96b71V+a 3B+aS  Bz  D{3Bb9+a! +a! 
93B+aS6b80V+a=  Bz  D{   Bz Dz Dz  By3B+a+ +a, 
92B+a/ 
96b81V+a/ 3B+a>  By  Dz3Bb<+a4 +a5 
93B+a>3D+a:  By  Dz B} 
9+a; 3B+a> 
93D+a> 3B+aS {  Bz {  D{3Bb<+aD +aD 
93B+aS3D+aJ  Bz  D{ B~ 
9+aJ 3B+aS  Bz  D{3Bb;+aO +aP 
93B+aS 
93D+aS 3B+aa ~ B{6b91V+aW +aX 
93B+a\ { 3Bb=+a\ +a\ 
93B+a_ b: },u(3@~+^U ~,u4+^U ~  B{ D{ D{  Bz3B+ag +ag 
92B+ak 
96b71V+ak 3B+b0 ,jG Bz3@{+ap 
{ 
02Lb=+as z  B} 
9+ax {  Bz {  D{  z,jG Bz+am3B+b0 {  Bz {  D{3Bb=+a~ +a 
93B+b06b80V+b  Bz  D{   Bz Dz Dz  By3B+b	 +b	 
92B+b
96b81V+b  By  Dz3Bb<+b +b 
93B+b3D+b  By  Dz B} 
9+b 3B+b 
93D+b 3B+b0 {  Bz {  D{3Bb<+b! +b" 
93B+b03D+b'  Bz  D{ B~ 
9+b( 3B+b0  Bz  D{3Bb;+b- +b- 
93B+b0 
93D+b03B+^UZ( }  b: },u( ~,u4+^U >y,~<z<<y<<<	<
<~<. S+k  BS,~> Bx  
x L6bY0V+bG  +bH  B6bY1V+bK +bX 
3Lb[+bS 
6bZ0V+bP   B S   ,j< BS   B6bZ0V+bW +bW  B+bH>~,~<<0<<> Bx,jG  B D2@+ba +c`     D   B~ D~ F}   D| D}  B|3B+bk +bk 
92B+bo 
96cb1V+bo 3B+c   D|3Bce+bs +bt 
93B+c6cb0V+c  B|  D|   B| D{ D|  B{3B+b~ +b~ 
92B+c 
96cc1V+c 3B+c  B{  D{3Bcd+c +c 
93B+c3D+c B~ 
9+c3B+c 
93D+c 3B+c 
93@|+c 2B+b_ ~  B} D| D}  B|3B+c +c 
92B+c 
96cb1V+c 3B+c]  B|  D|3Bce+c# +c# 
93B+c]6cb0V+c?  B|  D|   B| D{ D|  B{3B+c- +c. 
92B+c1 
96cc1V+c1 3B+c@  B{  D{3Bcd+c6 +c7 
93B+c@3D+c<  B{  D{ B~ 
9+c= 3B+c@ 
93D+c@ 3B+c] |  B| |  D|3Bcd+cF +cF 
93B+c] ,jG B|3@|+cL 
| 
02Lcc+cN |  B} 
9+cT |  B{ |  D|  |,jG B|+cI3B+c] |  B| |  D|3Bcc+cZ +cZ 
93B+c] 
93D+c] 3B+b_ ~ },u5+b_ >z,~<|<<{<<<
<@< Bx D  x  B6d90V+cp +cp  B~ d< x  ,jI B| @| 
    ~ B~ D} F} H| J| 
| L{ 
|L{6d90V+c~6d:1V+cs+d8d;j~,k2B+d0~,u5B|~,u6  D}3D+d
{ Lz6d:0V+d z +d   Bz Dy6d:0V+d02@y+d0 d; z,k2B+d*3@|+d* z,u5 
93B|+d  Dy3D+d* { |,k2B+d* z ~,jT3B+d'  |,si+d(  |,u7 { |,j< B{ z  Bz6d90V+d. +d/  Bz+d {  Bz   D6d;0V+d5 +d6  B~ z B{+c{>y,~<<<{<z<
<<@>
 Bx,jG  B D2@+dD +fY     D    B~ D~ F} H}   D| D|  B{3B+dO +dO 
92B+dS 
96fZ1V+dS 3B+eG6f[0V+eC  B{  D|   B{ D{ D{  Bz3B+d] +d] 
92B+da 
96f[1V+da 3B+eD  Bz  D{3Bfa+df +df 
93B+eD6f[0V+e@  Bz  D{   Bz Dz Dz  By3B+dp +dq 
92B+dt 
96f\1V+dt 3B+eA  By  Dz3Bf`+dy +dz 
93B+eA6f[0V+e=  By  Dz   By Dy Dy  Bx3B+e +e 
92B+e 
96f\1V+e 3B+e>  Bx  Dy3Bf`+e
93B+e>6f[0V+e:  Bx  Dy   Bx Dx Dx  Bw3B+e +e 
92B+e 
96f]1V+e 3B+e;6f[0V+e7  Bw  Dx   Bw Dw Dw  Bv3B+e% +e& 
92B+e) 
96f]1V+e) 3B+e8  Bv  Dw3Bf_+e. +e/ 
93B+e83D+e4  Bv  Dw B} 
9+e5 3B+e8 
93D+e8 3B+e; 
93@x+e; 3B+e> 
93@y+e> 3B+eA 
93@z+eA 3B+eD 
93@{+eD 3B+eG 
93@|+eG 3B+eM },tt B| 
f_2L+eL }+eL  B+dB ~  B| D| D|  B{3B+eS +eS 
92B+eW 
96fZ1V+eW 3B+fQ6f[0V+fN  B{  D|   B{ D{ D{  Bz3B+ea +ea 
92B+ee 
96f[1V+ee 3B+fN  Bz  D{3Bfa+ej +ej 
93B+fN6f[0V+fK  Bz  D{   Bz Dz Dz  By3B+et +eu 
92B+ex 
96f\1V+ex 3B+fK  By  Dz3Bf`+e} +e~ 
93B+fK6f[0V+fH  By  Dz   By Dy Dy  Bx3B+f +f 
92B+f
 
96f\1V+f
 3B+fH  Bx  Dy3Bf`+f +f 
93B+fH6f[0V+fE  Bx  Dy   Bx Dx Dx  Bw3B+f +f 
92B+f 
96f]1V+f 3B+fE6f[0V+f;  Bw  Dx   Bw Dw Dw  Bv3B+f) +f* 
92B+f- 
96f]1V+f- 3B+f<  Bv  Dw3Bf_+f2 +f3 
93B+f<3D+f8  Bv  Dw B} 
9+f9 3B+f< 
93D+f< 3B+fE x  Bw x  Dx3Bf^+fB +fB 
93B+fE D} 
9+fE 3B+fH 
93@y+fH 3B+fK 
93@z+fK 3B+fN 
93@{+fN 3B+fQ 
93@|+fQ	3B+dB },tt B| f^ ,k3B+fW }+fX  B+dB >v,~<{<<z<y<x<w<v
<
4<
2<
X>	 Bx,jG  B D2@+fg +hz     D   B~ D~ F}   D| D}  B|3B+fq +fq 
92B+fu 
96h{1V+fu 3B+gi6h|0V+ge  B|  D|   B| D{ D|  B{3B+f +f 
92B+g 
96h|1V+g 3B+gf  B{  D{3Bi+g +g 
93B+gf6h|0V+gb  B{  D{   B{ Dz D{  Bz3B+g +g 
92B+g 
96h}1V+g 3B+gc  Bz  Dz3Bi+g +g 
93B+gc6h|0V+g_  Bz  Dz   Bz Dy Dz  By3B+g& +g& 
92B+g* 
96h}1V+g* 3B+g`  By  Dy3Bi+g/ +g/ 
93B+g`6h|0V+g\  By  Dy   By Dx Dy  Bx3B+g9 +g: 
92B+g= 
96h~1V+g= 3B+g]6h|0V+gY  Bx  Dx   Bx Dw Dx  Bw3B+gG +gH 
92B+gK 
96h~1V+gK 3B+gZ  Bw  Dw3Bi+gP +gQ 
93B+gZ3D+gV  Bw  Dw B~ 
9+gW 3B+gZ 
93D+gZ 3B+g] 
93@x+g] 3B+g` 
93@y+g` 3B+gc 
93@z+gc 3B+gf 
93@{+gf 3B+gi 
93@|+gi 3B+go ~,tt B} 
h2L+gn ~+gn  B+fe ~  B} D| D}  B|3B+gu +gu 
92B+gy 
96h{1V+gy 3B+hs6h|0V+hp  B|  D|   B| D{ D|  B{3B+h +h 
92B+h 
96h|1V+h 3B+hp  B{  D{3Bi+h
 +h
 
93B+hp6h|0V+hm  B{  D{   B{ Dz D{  Bz3B+h +h 
92B+h 
96h}1V+h 3B+hm  Bz  Dz3Bi+h +h  
93B+hm6h|0V+hj  Bz  Dz   Bz Dy Dz  By3B+h* +h* 
92B+h. 
96h}1V+h. 3B+hj  By  Dy3Bi+h3 +h3 
93B+hj6h|0V+hg  By  Dy   By Dx Dy  Bx3B+h= +h> 
92B+hA 
96h~1V+hA 3B+hg6h|0V+h]  Bx  Dx   Bx Dw Dx  Bw3B+hK +hL 
92B+hO 
96h~1V+hO 3B+h^  Bw  Dw3Bi+hT +hU 
93B+h^3D+hZ  Bw  Dw B~ 
9+h[ 3B+h^ 
93D+h^ 3B+hg x  Bx x  Dx3Bh+hd +hd 
93B+hg D} 
9+hg 3B+hj 
93@y+hj 3B+hm 
93@z+hm 3B+hp 
93@{+hp 3B+hs 
93@|+hs 3B+fe ~,tt B} 
h2L+hx ~+hy  B+fe >v,~<|<<{<z<y<x<w<<"<
<
4<
2<
X<@< Bx D  
x L6iS0V+i
  +iV x ,jI B| @| 
    ~ B~ D} F} H| J| 
| L{ 
| L{6iS0V+i6iS1V+i +iR iU ~,k2B+iJ ~,u7 B{ ~,u8  D}3D+i( } },k2B+i(  },sb } },j< B}  Bz 
{ Lz6iT0V+i- z +i.   Bz Dy6iT0V+iJ2@y+iJ iU z,k2B+iD3@{+iD z,u7 
93B{+i8  Dy3D+iD | y,k2B+iD z ~,jT3B+iA  {,si+iB  {,u7 | y,j< B| z  Bz6iT0V+iH +iI  Bz+i/ {  Bz   D6iU0V+iO +iP  B~ z B{+i>y,~<<{<z<<
<<@>	 Bx,jG  B D2@+i^ +kP     D    B~ D~ F} H}   D| D|  B{3B+ii +ii 
92B+im 
96kR1V+im 3B+jO   D|3BkX+iq +ir 
93B+jO6kR0V+jL  B{  D|   B{ D{ D{  Bz3B+i| +i| 
92B+j 
96kS1V+j 3B+jL  Bz  D{3BkW+j +j 
93B+jL6kR0V+jI  Bz  D{   Bz Dz Dz  By3B+j +j 
92B+j 
96kS1V+j 3B+jI  By  Dz3BkW+j +j 
93B+jI6kR0V+jF  By  Dz   By Dy Dy  Bx3B+j# +j# 
92B+j' 
96kT1V+j' 3B+jF6kR0V+jC  Bx  Dy   Bx Dx Dx  Bw3B+j1 +j1 
92B+j5 
96kT1V+j5 3B+jC  Bw  Dx3BkV+j: +j: 
93B+jC3D+j@  Bw  Dx B} 
9+j@ 3B+jC 
93D+jC 3B+jF 
93@y+jF 3B+jI 
93@z+jI 3B+jL 
93@{+jL 3B+jO 
93@|+jO 3B+jV },tt B| 
kV2L+jT }+jU  B+i\ ~  B| D| D|  B{3B+j[ +j\ 
92B+j_ 
96kR1V+j_ 3B+kI  B{  D|3BkX+jd +je 
93B+kI6kR0V+kE  B{  D|   B{ D{ D{  Bz3B+jo +jo 
92B+js 
96kS1V+js 3B+kF  Bz  D{3BkW+jx +jx 
93B+kF6kR0V+kB  Bz  D{   Bz Dz Dz  By3B+k +k 
92B+k 
96kS1V+k 3B+kC  By  Dz3BkW+k +k
 
93B+kC6kR0V+k?  By  Dz   By Dy Dy  Bx3B+k +k 
92B+k 
96kT1V+k 3B+k@6kR0V+k6  Bx  Dy   Bx Dx Dx  Bw3B+k$ +k$ 
92B+k( 
96kT1V+k( 3B+k6  Bw  Dx3BkV+k- +k- 
93B+k63D+k3  Bw  Dx B} 
9+k3 3B+k6 
93D+k6 3B+k@ y  Bx y  Dy3BkU+k< +k= 
93B+k@ D} 
9+k@ 3B+kC 
93@z+kC 3B+kF 
93@{+kF 3B+kI 
93@|+kI	3B+i\ },tt B| kU ,k3B+kO }+kO  B+i\ >w,~<{<<z<y<x<w
<
4<
2<
X> Bx,jG  B D2@+k^ +mN     D   B~ D~ F}   D| D}  B|3B+kh +kh 
92B+kl 
96mP1V+kl 3B+lN   D|3BmU+kp +kq 
93B+lN6mP0V+lK  B|  D|   B| D{ D|  B{3B+k{ +k{ 
92B+k 
96mQ1V+k 3B+lK  B{  D{3BmU+l +l 
93B+lK6mP0V+lH  B{  D{   B{ Dz D{  Bz3B+l +l 
92B+l 
96mQ1V+l 3B+lH  Bz  Dz3BmT+l +l 
93B+lH6mP0V+lE  Bz  Dz   Bz Dy Dz  By3B+l" +l" 
92B+l& 
96mR1V+l& 3B+lE6mP0V+lB  By  Dy   By Dx Dy  Bx3B+l0 +l0 
92B+l4 
96mR1V+l4 3B+lB  Bx  Dx3BmT+l9 +l9 
93B+lB3D+l?  Bx  Dx B~ 
9+l? 3B+lB 
93D+lB 3B+lE 
93@y+lE 3B+lH 
93@z+lH 3B+lK 
93@{+lK 3B+lN 
93@|+lN 3B+lU ~,tt B} 
mS2L+lS ~+lT  B+k\ ~  B} D| D}  B|3B+lZ +l[ 
92B+l^ 
96mP1V+l^ 3B+mH  B|  D|3BmU+lc +ld 
93B+mH6mP0V+mD  B|  D|   B| D{ D|  B{3B+ln +ln 
92B+lr 
96mQ1V+lr 3B+mE  B{  D{3BmU+lw +lw 
93B+mE6mP0V+mA  B{  D{   B{ Dz D{  Bz3B+m +m 
92B+m 
96mQ1V+m 3B+mB  Bz  Dz3BmT+m
 +m 
93B+mB6mP0V+m>  Bz  Dz   Bz Dy Dz  By3B+m +m 
92B+m 
96mR1V+m 3B+m?6mP0V+m5  By  Dy   By Dx Dy  Bx3B+m# +m# 
92B+m' 
96mR1V+m' 3B+m5  Bx  Dx3BmT+m, +m, 
93B+m53D+m2  Bx  Dx B~ 
9+m2 3B+m5 
93D+m5 3B+m? y  By y  Dy3BmS+m; +m< 
93B+m? D} 
9+m? 3B+mB 
93@z+mB 3B+mE 
93@{+mE 3B+mH 
93@|+mH 3B+k\ ~,tt B} 
mS2L+mM ~+mM  B+k\ >w,~<|<<{<z<y<x<<"<
<
4<
2<
XCHRCNSARG!A character constant was used as an actual argument to subroutine %wHOLCNSARG!A Hollerith constant was used as an actual argument to subroutine %w>	 Bx D,jG  B D~2@+mn +ox     D  B~ D}   D| D}  B|3B+mw +mw 
92B+m{ 
96oz1V+m{ 3B+no6oz0V+nk  B|  D|   B| D{ D|  B{3B+n +n 
92B+n	 
96o{1V+n	 3B+nl  B{  D{3Bp+n +n 
93B+nl6oz0V+nh  B{  D{   B{ Dz D{  Bz3B+n +n 
92B+n 
96o{1V+n 3B+ni  Bz  Dz3Bp+n! +n" 
93B+ni6oz0V+ne  Bz  Dz   Bz Dy Dz  By3B+n, +n, 
92B+n0 
96o|1V+n0 3B+nf  By  Dy3Bp+n5 +n5 
93B+nf6oz0V+nb  By  Dy   By Dx Dy  Bx3B+n? +n@ 
92B+nC 
96o|1V+nC 3B+nc6oz0V+n_  Bx  Dx   Bx Dw Dx  Bw3B+nM +nN 
92B+nQ 
96o}1V+nQ 3B+n`  Bw  Dw3Bp+nV +nW 
93B+n`3D+n\  Bw  Dw B} 
9+n] 3B+n` 
93D+n` 3B+nc 
93@x+nc 3B+nf 
93@y+nf 3B+ni 
93@z+ni 3B+nl 
93@{+nl 3B+no 
93@|+no 3B+nu ,tu  p,j>  o o,s%+ml ~  B} D| D}  B|3B+nz +n{ 
92B+n~ 
96oz1V+n~ 3B+or6oz0V+oo  B|  D|   B| D{ D|  B{3B+o +o	 
92B+o
 
96o{1V+o
 3B+oo  B{  D{3Bp+o +o 
93B+oo6oz0V+ol  B{  D{   B{ Dz D{  Bz3B+o +o 
92B+o  
96o{1V+o  3B+ol  Bz  Dz3Bp+o% +o% 
93B+ol6oz0V+oi  Bz  Dz   Bz Dy Dz  By3B+o/ +o0 
92B+o3 
96o|1V+o3 3B+oi  By  Dy3Bp+o8 +o9 
93B+oi6oz0V+of  By  Dy   By Dx Dy  Bx3B+oC +oC 
92B+oG 
96o|1V+oG 3B+of6oz0V+oc  Bx  Dx   Bx Dw Dx  Bw3B+oQ +oQ 
92B+oU 
96o}1V+oU 3B+oc  Bw  Dw3Bo~+oZ +oZ 
93B+oc3D+o`  Bw  Dw B} 
9+o` 3B+oc 
93D+oc 3B+of 
93@x+of 3B+oi 
93@y+oi 3B+ol 
93@z+ol 3B+oo 
93@{+oo 3B+or 
93@|+or 3B+ml ,tu  o~,j>  o} o,s%+ml ~>v,~<|<<{<z<y<x<w
<
<
4<
2<
XCOMPARMES%ppispinaasCOMMONeblockeandmanaargumentltot%p.men,>,tuuxp,j>>pp>+s%<p.>+s%<
XA<@<><@<
<@<8<@<@<3<@<	h<@<C<@<	R<@<	4<@<<@<	h<@<
PG
Q<@<H
R<@<H
S<@<<@<I
<X
YZ<l
B<@<nED-DEF-LISTL
D20FOR$NAMELIST-NAMES, hNMLFMT
D20FOR$CURRENT-STMT-IShsASTERISKOUNITBDDFLTFMTAneeditedescriptor,'%p,hasno default value.n adSZMSMTCHF,Edit descriptor A%p requires a variable with an additional %p word(s) of storage on a VAX.BADFRMITMAn edit descriptor R was replaced with descriptor A.ac<

@0TEG ARA> Bx   B D  B~6}80V+tI @~ @} @} @| B} ~  B}6}80V+r@ ~ ~,j< B~ ~  D~+r9 ~  B~2B+r93@~+sG ~  B| ~  D~ B~  F} ,jG 
    B| D{ F{ Hz Jz2@|+rO +sE |  By |  D|  By Dy   Bx Dx Dx  Bw3B+rY +rZ 
92B+r] 
96}91V+r] 3B+r  Bw  Dx3B}G+rb +rc 
93B+r  Bw  Dx3B}F+rh +rh 
93B+r ,jG Bw3@x+rn 
x 
02L}F+rp w  By 
9+rv x  Bw x  Dx  w,jG Bw+rk3B+r x  Bw x  Dx3B}F+r| +r| 
93B+r 
93D+r 3B+rM3@|+s$ y,k Bx Bx6}81V+s +s 
93B+s x 3B}E+s
 +s 
93B+s }E }D }D,s% y,o? }C,jI }F,j| }G,j|+s  x 8 
}E2L8+s }E }D }D,s% y,o? Bx }C x ,j< }B,j<  x,jI }F,j| }G,j|+s  y Bx6}80V+sC  ~,k+sC y,k Bx Bx6}81V+s( +s) 
93B+s- x 3B}E+s- +s- 
93B+s5 }E }D }D,s% y,o? }C,jI }F,j| }G,j|+sB x 8 
}E2L8+sB }E }D }D,s% y,o? Bx }C x ,j< }B,j<  x,jI }F,j| }G,j|+sB y ~ B8 

9 L{+rM {3B+r@ 
9+tI 
} L} } 
9 B| D{ },jG 
    B{ Dz Fz Hy Jy2@{+sR +tG {  Bx {  D{  Bx Dx   Bw Dw Dw  Bv3B+s\ +s\ 
92B+s` 
96}91V+s` 3B+t  Bv  Dw3B}G+se +se 
93B+t  Bv  Dw3B}F+sj +sk 
93B+t ,jG Bv3@w+sp 
w 
02L}F+ss v  Bx 
9+sx w  Bv w  Dw  v,jG Bv+sm3B+t w  Bv w  Dw3B}F+s~ +s 
93B+t 
93D+t 3B+sP3@|+t& x,k Bw Bw6}81V+t +t	 
93B+t3B}E+t
93B+t }E }D }D,s% x,o? }C,jI }F,j| }G,j|+t" w 8 
}E2L8+t" }E }D }D,s% x,o? Bw }C w ,j< }B,j<  w,jI }F,j| }G,j|+t" x Bw6}80V+tF  {,k+tF x,k Bw Bw6}81V+t+ +t+ 
93B+t0 w 3B}E+t/ +t0 
93B+t7 }E }D }D,s% x,o? }C,jI }F,j| }G,j|+tE w 8 
}E2L8+tD }E }D }D,s% x,o? Bw }C w ,j< }B,j<  w,jI }F,j| }G,j|+tE x { B8 

9 Lz+sP z3B+tI 
9  B~6}80V+uo @~ @} @} @| @| B} ~  B}6}80V+tV ~ ~,j< B~ ~  D~+tO ~  B~2B+tO3@~+u% ~  B{ ~  D~ B~  F} ,jG 
    B{ D{ Fz Hz Jy2@{+te +u" {  By {  D{   By Dx Fx   Bw Dw Dw  Bv3B+tp +tq 
92B+tt 
96}91V+tt 3B+u ,jG Bv3@w+tz 
w 
02L}B+t| v  Bx 
9+u w  Bv w  Dw  v,jG Bv+tw3B+u w  Bv w  Dw3B}B+u +u 
93B+u3D+u  Bv  Dw Bx 
9+u 3B+u 
93D+u 3B+tc3@|+u }A x,j< }B,j|  x,jI Bw6}80V+u   ~,k+u  }A x,j< }B,j|  x,jI ~ B8 

9 L{+tc {3B+tV 

9 L|+tV 
} L} } 
9 B{ D{ },jG 
    Bz Dz Fy Hy Jx2@z+u/ +ul z  Bx z  Dz   Bx Dw Fw   Bv Dv Dv  Bu3B+u: +u; 
92B+u> 
96}:1V+u> 3B+u[ ,jG Bu3@v+uD 
v 
02L}B+uF u  Bw 
9+uL v  Bu v  Dv  u,jG Bu+uA3B+u[ v  Bu v  Dv3B}B+uR +uR 
93B+u[3D+uX  Bu  Dv Bw 
9+uX 3B+u[ 
93D+u[ 3B+u-3@{+ue }A w,j< }B,j|  w,jI Bv6}80V+uj  {,k+uj }A w,j< }B,j|  w,jI { B8 

9 Lz+u- z3B+un 

9 L| |  B~6}80V+w @~ @} @} @| @| B} ~  B}6}80V+u{ ~ ~,j< B~ ~  D~+ut ~  B~2B+ut3@~+vJ ~  B{ ~  D~ B~  F} ,jG 
    B{ D{ Fz Hz Jy2@{+v +vG {  By {  D{   By Dx Fx   Bw Dw Dw  Bv3B+v +v 
92B+v 
96}91V+v 3B+v7 ,jG Bv3@w+v 
w 
02L}A+v" v  Bx 
9+v' w  Bv w  Dw  v,jG Bv+v3B+v7 w  Bv w  Dw3B}A+v- +v. 
93B+v73D+v3  Bv  Dw Bx 
9+v4 3B+v7 
93D+v7 3B+v	3@|+vA }A x,j< }A,j|  x,jI Bw6}80V+vF  ~,k+vF }A x,j< }A,j|  x,jI ~ B8 

9 L{+v	 {3B+u{ 

9 L|+u{ 
} L} } 
9 B{ D{ },jG 
    Bz Dz Fy Hy Jx2@z+vU +w z  Bx z  Dz   Bx Dw Fw   Bv Dv Dv  Bu3B+v` +v` 
92B+vd 
96}:1V+vd 3B+w ,jG Bu3@v+vi 
v 
02L}A+vl u  Bw 
9+vq v  Bu v  Dv  u,jG Bu+vf3B+w v  Bu v  Dv3B}A+vw +vx 
93B+w3D+v}  Bu  Dv Bw 
9+v~ 3B+w 
93D+w 3B+vS3@{+w }A w,j< }A,j|  w,jI Bv6}80V+w  {,k+w }A w,j< }A,j|  w,jI { B8 

9 Lz+vS z3B+w 

9 L| |  B~6}80V+x: @~ @} @} @| @| B} ~  B}6}80V+w! ~ ~,j< B~ ~  D~+w ~  B~2B+w3@~+wp ~  B{ ~  D~ B~  F} ,jG 
    B{ D{ Fz Hz Jy2@{+w0 +wm {  By {  D{   By Dx Fx   Bw Dw Dw  Bv3B+w; +w< 
92B+w? 
96}91V+w? 3B+w\ ,jG Bv3@w+wE 
w 
02L}@+wG v  Bx 
9+wM w  Bv w  Dw  v,jG Bv+wB3B+w\ w  Bv w  Dw3B}@+wS +wS 
93B+w\3D+wY  Bv  Dw Bx 
9+wY 3B+w\ 
93D+w\ 3B+w.3@|+wf }A x,j< }@,j|  x,jI Bw6}80V+wk  ~,k+wk }A x,j< }@,j|  x,jI ~ B8 

9 L{+w. {3B+w! 

9 L|+w! 
} L} } 
9 B{ D{ },jG 
    Bz Dz Fy Hy Jx2@z+wz +x7 z  Bx z  Dz   Bx Dw Fw   Bv Dv Dv  Bu3B+x +x 
92B+x	 
96}:1V+x	 3B+x& ,jG Bu3@v+x 
v 
02L}@+x u  Bw 
9+x v  Bu v  Dv  u,jG Bu+x
3B+x& v  Bu v  Dv3B}@+x +x 
93B+x&3D+x#  Bu  Dv Bw 
9+x# 3B+x& 
93D+x& 3B+wx3@{+x0 }A w,j< }@,j|  w,jI Bv6}80V+x5  {,k+x5 }A w,j< }@,j|  w,jI { B8 

9 Lz+wx z3B+x9 

9 L| |  B~6}80V+y_ @~ @} @} @| @| B} ~  B}6}80V+xF ~ ~,j< B~ ~  D~+x? ~  B~2B+x?3@~+y ~  B{ ~  D~ B~  F} ,jG 
    B{ D{ Fz Hz Jy2@{+xV +y {  By {  D{   By Dx Fx   Bw Dw Dw  Bv3B+xa +xa 
92B+xe 
96}91V+xe 3B+y ,jG Bv3@w+xj 
w 
02L}@+xm v  Bx 
9+xr w  Bv w  Dw  v,jG Bv+xg3B+y w  Bv w  Dw3B}@+xx +xy 
93B+y3D+x~  Bv  Dw Bx 
9+x 3B+y 
93D+y 3B+xT3@|+y
 }A x,j< }@,j|  x,jI Bw6}80V+y  ~,k+y }A x,j< }@,j|  x,jI ~ B8 

9 L{+xT {3B+xF 

9 L|+xF 
} L} } 
9 B{ D{ },jG 
    Bz Dz Fy Hy Jx2@z+y  +y\ z  Bx z  Dz   Bx Dw Fw   Bv Dv Dv  Bu3B+y+ +y+ 
92B+y/ 
96}:1V+y/ 3B+yL ,jG Bu3@v+y4 
v 
02L}@+y7 u  Bw 
9+y< v  Bu v  Dv  u,jG Bu+y13B+yL v  Bu v  Dv3B}@+yB +yC 
93B+yL3D+yH  Bu  Dv Bw 
9+yI 3B+yL 
93D+yL 3B+y3@{+yV }A w,j< }@,j|  w,jI Bv6}80V+y[  {,k+y[ }A w,j< }@,j|  w,jI { B8 

9 Lz+y z3B+y_ 

9 L| |  B~6}80V+zw @~ @} @} @| @| B} ~  B}6}80V+yl ~ ~,j< B~ ~  D~+ye ~  B~2B+ye3@~+z4 ~  B{ ~  D~ B~  F} ,jG 
    B{ D{ Fz Hz Jy2@{+y{ +z1 {  By {  D{   By Dx Fx   Bw Dw Dw  Bv3B+z +z 
92B+z
 
96}91V+z
 3B+z  ,jG Bv3@w+z 
w 
02L}?+z v  Bx 
9+zwBvBwDwDBv,jGBv+z 
93B+z  Dx 
93B+yy3@|+z) x }?,j<  x,jI Bw6}80V+z-  ~,k+z- x }?,j<  x,jI ~ B8 }> }> }D,s% 

9 L{+yy {3B+yl 

9 L|+yl 
} L} } 
9 B{ D{ },jG 
    Bz Dz Fy Hy Jx2@z+z> +zt z  Bx z  Dz   Bx Dw Fw   Bv Dv Dv  Bu3B+zI +zJ 
92B+zM 
96}:1V+zM 3B+zc ,jG Bu3@v+zS 
v 
02L}?+zU u  Bw 
9+z[ v  Bu v  Dv  u,jG Bu+zP3B+zc v  Bu v  Dv3B}?+za +za 
93B+zc Dw 
93B+z<3@{+zl w }?,j<  w,jI Bv6}80V+zp  {,k+zp w }?,j<  w,jI { B8 }> }> }D,s% 

9 Lz+z< z3B+zv 

9 L| |  B~6}80V+|+ @~ @} @} @| @| B} ~  B}6}80V+{ ~ ~,j< B~ ~  D~+z| ~  B~2B+z|3@~+{Z ~  B{ ~  D~ B~  F} ,jG 
    B{ D{ Fz Hz Jy2@{+{ +{W {  By {  D{   By Dx Fx   Bw Dw Dw  Bv3B+{ +{ 
92B+{" 
96}91V+{" 3B+{? ,jG Bv3@w+{' 
w 
02L}?+{* v  Bx 
9+{/ w  Bv w  Dw  v,jG Bv+{$3B+{? w  Bv w  Dw3B}?+{5 +{6 
93B+{?3D+{;  Bv  Dw Bx 
9+{< 3B+{? 
93D+{? 3B+{ x  Z",t} BwZ$,jjZ$,jj BwZ$ w,jjZ$,jj  w,jR2B+{UZ$ w,jjZ$,jj BwZ$ w,jjZ$,jj  w,jh  w }=,j>  }= }D,s% 

9 L{+{ {3B+{ 

9 L|+{ 
} L} } 
9 B{ D{ },jG 
    Bz Dz Fy Hy Jx2@z+{d +|( z  Bx z  Dz   Bx Dw Fw   Bv Dv Dv  Bu3B+{o +{p 
92B+{s 
96}:1V+{s 3B+| ,jG Bu3@v+{y 
v 
02L}?+{{ u  Bw 
9+| v  Bu v  Dv  u,jG Bu+{v3B+| v  Bu v  Dv3B}?+| +| 
93B+|3D+| Bw 
9+|3B+| 
93D+| 3B+{b w  Z",t} BvZ$,jjZ$,jj BvZ$ v,jjZ$,jj  v,jR2B+|'Z$ v,jjZ$,jj BvZ$ v,jjZ$,jj  v,jh  v }=,j>  }= }D,s% 

9 Lz+{b z3B+|+ 

9 L| |  B~6}80V+}7 @~ @} @} @| @| B} ~  B}6}80V+|8 ~ ~,j< B~ ~  D~+|1 ~  B~2B+|13@~+|z ~  B{ ~  D~ B~  F} ,jG 
    B{ D{ Fz Hz Jy2@{+|G +|w {  By {  D{  By Dx   Bx Dw Dx  Bw3B+|Q +|R 
92B+|U 
96}:1V+|U 3B+|l ,jG Bw3@w+|\  w ,k3B+|^ w  Bx 
9+|d w  Bv w  Dw  w,jG Bw+|X3B+|l w  Bw w  Dw ,k3B+|l 
93@w+|l 3B+|E 
y6};1V+|p y +|r y    }<,j>  }< }D,s% 

9 L{+|E {3B+|8 

9 L|+|8 
} L} } 
9 B{ D{ },jG 
    Bz Dz Fy Hy Jx2@z+} +}4 z  Bx z  Dz  Bx Dw   Bw Dv Dw  Bv3B+} +} 
92B+} 
96};1V+} 3B+}) ,jG Bv3@v+}  v ,k3B+} v  Bw 
9+}! v  Bu v  Dv  v,jG Bv+}3B+}) v  Bv v  Dv ,k3B+}) 
93@v+}) 3B+} 
x6};1V+}- x +}/ x    }<,j>  }< }D,s% 

9 Lz+} z3B+}6 

9L|#|)>t,~<<w<v<u<w<0<v}W      ,j< B 
9 }X     ,k      B+}J>,~<) }\ ,lo  B,~<)> Bx   B  B6k0V+i @~ @~ @} @} @| B}   B~6k0V+}l ~ ,j< B~   D+}e   B2B+}e3@~+- ~  B| ~  D~ B  F~ ,jG   B| D{ F{2@|+}z +* |  Bz |  D|  Bz Dz   By Dy Dy  Bx3B+~ +~ 
92B+~ 
96k1V+~ 3B+  Bx  Dy3Bt+~
93B+  Bx  Dy3Bs+~ +~ 
93B+6l0V+  Bx  Dy   Bx Dx Dx  Bw3B+~ +~ 
92B+~! 
96l1V+~! 3B+  Bw  Dx3Bs+~& +~& 
93B+6l0V+  Bw  Dx   Bw Dw Dw  Bv3B+~0 +~1 
92B+~4 
96m1V+~4 3B+  Bv  Dw3Br+~9 +~: 
93B+6l0V+~}  Bv  Dw   Bv Dv Dv  Bu3B+~D +~D 
92B+~H 
96m1V+~H 3B+~~  Bu  Dv3Br+~M +~M 
93B+~~6l0V+~z  Bu  Dv   Bu Du Du  Bt3B+~W +~X 
92B+~[ 
96n1V+~[ 3B+~{6l0V+~w  Bt  Du   Bt Dt Dt  Bs3B+~e +~f 
92B+~i 
96n1V+~i 3B+~x  Bs  Dt3Bq+~n +~o 
93B+~x3D+~t  Bs  Dt Bz 
9+~u 3B+~x 
93D+~x 3B+~{ 
93@u+~{ 3B+~~ 
93@v+~~ 3B+ 
93@w+ 3B+ 
93@x+ 3B+ 
93@y+ 3B+}x3@|+6o0V+ q z,kv3B+ z q,jm,jG  r,jm  r,jm  s,jm  s p,jf+ z By6k0V+)  ,k+)6o0V+' q z,kv3B+' z q,jm,jG  r,jm  r,jm  s,jm  s p,jf+( z  B8 

9 L{+}x {3B+}l 

9 L}+}l 
} L~ ~ 
9 B| D{ ~,jG   B{ Dz Fz2@{+6 +f {  By {  D{  By Dy   Bx Dx Dx  Bw3B+@ +@ 
92B+D 
96l1V+D 3B+C  Bw  Dx3Bt+I +I 
93B+C  Bw  Dx3Bs+N +O 
93B+C6l0V+?  Bw  Dx   Bw Dw Dw  Bv3B+Y +Y 
92B+] 
96m1V+] 3B+@  Bv  Dw3Bs+b +b 
93B+@6l0V+<  Bv  Dw   Bv Dv Dv  Bu3B+l +m 
92B+p 
96m1V+p 3B+=  Bu  Dv3Br+u +v 
93B+=6l0V+9  Bu  Dv   Bu Du Du  Bt3B+ + 
92B+ 
96n1V+ 3B+:  Bt  Du3Br+	 +	 
93B+:6l0V+6  Bt  Du   Bt Dt Dt  Bs3B+ + 
92B+ 
96n1V+ 3B+76l0V+3  Bs  Dt   Bs Ds Ds  Br3B+! +" 
92B+% 
96o1V+% 3B+4  Br  Ds3Bq+* ++ 
93B+43D+0  Br  Ds By 
9+1 3B+4 
93D+4 3B+7 
93@t+7 3B+: 
93@u+: 3B+= 
93@v+= 3B+@ 
93@w+@ 3B+C 
93@x+C 3B+43@|+V6p0V+R q y,kv3B+R y q,jm,jG  r,jm  r,jm  s,jm  s p,jf+R y Bx6k0V+e  {,k+e6p0V+c q y,kv3B+c y q,jm,jG  r,jm  r,jm  s,jm  s p,jf+d y { B8 

9 Lz+4 z3B+i 

9 L} } >r,~<<x<<w<v<u<t<s<z<r<y<p<)<
<
4<
2<
X<<qASGOTOLSTVAX/VMS FORTRAN ignores statement label lists in ASSIGNED GOTOs. 
 
060V+  8 8 

2L8+,j;Z$,jg3B+ 
 	 	+s% ,~<0<tv<
,>   ,nd2B+ x    ,nd2B+ 
9+ x   ,nd3B+ + 
9>,~<<	7> Bx   B D  B~6u0V+4 @~ @} @} B} 
9 B| },jG @| 
    B| D{ F{ Hz Jz 
| Ly2@|+- +b |  By |  D|   By Dx Fx   Bw Dw Dw  Bv3B+8 +8 
92B+< 
96u1V+< 3B+[  Bv  Dw3B{+A +A 
93B+[  Bv  Dw3B{+F +G 
93B+[3D+L  Bv  Dw Bx 
9+M 3B+[  Bv  Dw3Bz+R +R 
93B+[3D+X  Bv  Dw Bx 
9+X 3B+[ 
93D+[ 3B++ 
x3Lz+a x  ,jf x,u 

9 L{++ {3B+e 
9+4 ~  B},jG @| 
    B| D| F{ H{ Jz 
| Lz2@|+o +$ |  By |  D|   By Dy Fx   Bx Dw Dx  Bw3B+z +z 
92B+~ 
96v1V+~ 3B+  Bw  Dw3B{+ + 
93B+  Bw  Dw3B{+ +	 
93B+3D+  Bw  Dw Bx 
9+ 3B+  Bw  Dw3Bz+ + 
93B+3D+  Bw  Dw By 
9+ 3B+ 
93D+ 3B+m 
y3Lz+# y  ,jf y,u 

9 L|+m |3B+' 
9+46v0V+, ~ ~,j< B~ ~  D~+e ~  B~2B+e3@~+4 ~  B| ~  D~ B~+,  B~6u0V+s @~ @} @} B} 
9 B| },jG @| 
    B| D{ F{ Hz Jz 
| Ly2@|+B +M |  By |  D|    By Dx Fx Hw   Bw Dv Dw  Bv3B+N +O 
92B+R 
96w1V+R 3B++  Bv  Dv3B{+W +X 
93B++  Bv  Dv3B{+] +] 
93B++3D+c  Bv  Dv Bw 
9+c 3B++  Bv  Dv3Bz+h +i 
93B++6w0V+  Bv  Dv   Bv Du Dv  Bu3B+s +s 
92B+w 
96x1V+w 3B+  Bu  Du3By+| +| 
93B+3D+  Bu  Du Bx 
9+ 3B+ 
93D+ 3B++ v  Bv v  Dv3By+ +
 
93B++6w0V+(  Bv  Dv   Bv Du Dv  Bu3B+ + 
92B+ 
96x1V+ 3B+(  Bu  Du3By+ + 
93B+(3D+%  Bu  Du Bx 
9+% 3B+( 
93D+( 3B++ 
93@v++ 3B+@3@|+> x y,jm Bw x y,jm Bv x y,jm 
 y v y w,k? z,j| w,j| {,j| {,j| Bw6u0V+K  ~,k+K x y,jm Bw x y,jm Bv x y,jm 
 y v y w,k? z,j| w,j| {,j| {,j| ~ B8 

9 L{+@ {3B+O 
9+s ~  B},jG @| 
    B| D| F{ H{ Jz 
| Lz2@|+Y +d |  By |  D|    By Dy Fx Hx   Bw Dw Dw  Bv3B+e +f 
92B+i 
96u1V+i 3B+B  Bv  Dw3B{+n +o 
93B+B  Bv  Dw3B{+t +t 
93B+B3D+z  Bv  Dw Bx 
9+z 3B+B  Bv  Dw3Bz+ + 
93B+B6w0V+  Bv  Dw   Bv Dv Dv  Bu3B+
 +
 
92B+ 
96x1V+ 3B+  Bu  Dv3By+ + 
93B+3D+  Bu  Dv Bx 
9+ 3B+ 
93D+ 3B+B w  Bv w  Dw3By+" +# 
93B+B6w0V+?  Bv  Dw   Bv Dv Dv  Bu3B+- +- 
92B+1 
96x1V+1 3B+?  Bu  Dv3By+6 +6 
93B+?3D+<  Bu  Dv By 
9+< 3B+? 
93D+? 3B+B 
93@w+B 3B+W3@}+U x y,jm Bw y y,jm Bw y y,jm 
 y w y w,k? z,j| x,j| {,j| {,j| Bw6u0V+b  ~,k+b x y,jm Bw y y,jm Bw y y,jm 
 y w y w,k? z,j| x,j| {,j| {,j| ~ B8 

9 L|+W |3B+f 
9+s6v0V+l ~ ~,j< B~ ~  D~+O ~  B~2B+O3@~+s ~  B| ~  D~ B~+l >t,~<<v<w<}<v<<u<u<<
<<<<H,>3@x+6
1V+0v+ x+Z"  x,sZ3@y+
6
1V+0v+ y+Z"  x>+sZ >,~<x<yWRTDFLTMDA WRITE to the default unit was modified to include (UNIT=%p)..<q%pMS<<<@>
 Bx D   B D~  B~6
)0V+ @} @} @| B} 
9 B| },jG 
    B{ D{ Fz Hz Jy2@{+* + {  By {  D{  By Dx   Bx Dw Dx  Bw3B+4 +5 
92B+8 
96
*1V+8 3B+D  Bw  Dw3B
7+= +> 
93B+D  Bw  Dw ,k3B+D 
w Lx 
93B+(3@|+f  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bx x Bw6
)1V+T +U 
93B+Y w 3B
3+Y +Y 
93B+\ x +\ x 
2,j| 
2,j| 
3,j| x,j| 
1,j| 
7,j| Bx6
)0V+  ~,k+  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bx x Bw6
)1V+t +u 
93B+y w 3B
3+y +y 
93B+| x +| x 
2,j| 
2,j| 
3,j| x,j| 
1,j| 
7,j| ~ B8  
1,j>  
0 
0,s% 

9 L{+( {3B+ 
9+ ~  B},jG 
    B| D{ F{ Hz Jz2@|+ +q |  By |  D|  By Dy   Bx Dx Dx  Bw3B+ + 
92B+! 
96
*1V+! 3B+-  Bw  Dx3B
7+& +' 
93B+-  Bw  Dx ,k3B+- 
x Ly 
93B+3@|+O  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bx y Bx6
)1V+= +> 
93B+B x 3B
3+B +B 
93B+E y +E y 
2,j| 
2,j| 
3,j| x,j| 
1,j| 
7,j| Bx6
)0V+l  ~,k+l  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bx y Bx6
)1V+] +^ 
93B+b x 3B
3+b +b 
93B+e y +e y 
2,j| 
2,j| 
3,j| x,j| 
1,j| 
7,j| ~ B8  
1,j>  
0 
0,s% 

9 L{+ {3B+t 
9+6
+0V+y } ~,j< B} ~  D~+ ~  B~2B+3@}+ }  B| }  D} B~+y ~ B~6
)0V+	' @} @} @| B} 
9 B| },jG 
B{D{FzHzJy2@{++ Bw Dw Dw  Bv3B+ + 
92B+ 
96
+1V+ 3B+A  Bv  Dw3B
7+" +" 
93B+A6
,0V+>  Bv  Dw   Bv Dv Dv  Bu3B+, +- 
92B+0 
96
,1V+0 3B+?  Bu  Dv3B
/+5 +6 
93B+?3D+;  Bu  Dv Bx 
9+< 3B+? 
93D+? 3B+A 
w Lx 
93B+
3@|+g  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bw x 
/,jm  
4 
/,jf Bw x Bv6
)1V+U +V 
93B+Z v 3B
3+Z +Z 
93B+] x +] x 
2,j| w,j| 
3,j| w,j| 
1,j| 
7,j| Bw6
)0V+  ~,k+  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bw x 
/,jm  
4 
/,jf Bw x Bv6
)1V+y +z 
93B+~ v 3B
3+~ +~ 
93B+ x + x 
2,j| w,j| 
3,j| w,j| 
1,j| 
7,j| ~ B8  
1,j>  
0 
0,s% 

9 L{+
 {3B+ 
9+	' ~  B},jG 
    B| D{ F{ Hz Jz2@|+ +	 |  By |  D|   By Dy Fx   Bx Dw Dx  Bw3B+# +$ 
92B+' 
96
*1V+' 3B+L  Bw  Dw3B
7+, +- 
93B+L6
,0V+I  Bw  Dw   Bw Dv Dw  Bv3B+7 +7 
92B+; 
96
-1V+; 3B+I  Bv  Dv3B
/+@ +@ 
93B+I3D+F  Bv  Dv By 
9+F 3B+I 
93D+I 3B+L 
w Lx 
93B+3@|+r  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bx y 
/,jm  
4 
/,jf Bw x Bw6
)1V+` +` 
93B+e w 3B
3+d +e 
93B+g x +h x 
2,j| w,j| 
3,j| x,j| 
1,j| 
7,j| Bx6
)0V+	  ~,k+	  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bx y 
/,jm  
4 
/,jf Bw x Bw6
)1V+	 +	 
93B+		 w 3B
3+	 +		 
93B+	 x +	
 x 
2,j| w,j| 
3,j| x,j| 
1,j| 
7,j| ~ B8  
1,j>  
0 
0,s% 

9 L{+ {3B+	 
9+	'6
+0V+	  } ~,j< B} ~  D~+ ~  B~2B+3@}+	' }  B| }  D} B~+	  ~ B~6
)0V+
( @} @} @| B} 
9 B| },jG 
    B{ D{ Fz Hz Jy2@{+	4 +
a {  By {  D{    By Dx Fx Hw   Bw Dv Dw  Bv3B+	@ +	A 
92B+	D 
96
-1V+	D 3B+
1  Bv  Dv3B
7+	I +	J 
93B+
1  Bv  Dv3B
1+	O +	O 
93B+
1 ,jG Bv3@v+	r 
v6
-0V+	p v   Bu Du Du  Bt3B+	[ +	[ 
92B+	_ 
96
.1V+	_ 3B+	q  Bt  Du3B
3+	d +	d 
93B+	q  Bt  Du3B
4+	i +	j 
93B+	q  Bt  Du ,k3B+	q 
93@u+	q 3B+	t v  Bw 
9+	z v  Bu v  Dv  v,jG Bv+	R3B+
16
+0V+
 v  Bv v  Dv   Bv Du Dv  Bu3B+
 +
 
92B+
	 
96
.1V+
	 3B+
  Bu  Du3B
3+
 +
 
93B+
  Bu  Du3B
4+
 +
 
93B+
  Bu  Du ,k3B+
 
93@u+
 3B+
1 ,jG Bv3@v+
  
v 
02L
2+
# v  Bx 
9+
( v  Bu v  Dv  v,jG Bv+
3B+
1 v  Bv v  Dv3B
2+
. +
/ 
93B+
1 Dx 
93B+	23@|+
I  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bw x 
2,j<  x,jI w,j|  w,jI 
1,j| 
7,j| Bw6
)0V+
\  ~,k+
\  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bw x 
2,j<  x,jI w,j|  w,jI 
1,j| 
7,j| ~ B8  
1,j>  
0 
0,s% 

9 L{+	2 {3B+
c 
9+
( ~  B},jG 
    B| D{ F{ Hz Jz2@|+
l +
 |  By |  D|    By Dy Fx Hx   Bw Dw Dw  Bv3B+
x +
x 
92B+
| 
96
+1V+
| 3B+h  Bv  Dw3B
7+ + 
93B+h  Bv  Dw3B
1+ + 
93B+h ,jG Bv3@w+) 
w6
-0V+( w   Bv Du Dv  Bu3B+ + 
92B+ 
96
.1V+ 3B+(  Bu  Du3B
3+ + 
93B+(  Bu  Du3B
4+! +! 
93B+(  Bu  Du ,k3B+( 
93@u+( 3B+, v  Bx 
9+1 w  Bv w  Dw  v,jG Bv+	3B+h6
*0V+R w  Bv w  Dw   Bv Dv Dv  Bu3B+< += 
92B+@ 
96
,1V+@ 3B+R  Bu  Dv3B
3+E +F 
93B+R  Bu  Dv3B
4+K +K 
93B+R  Bu  Dv ,k3B+R 
93@v+R 3B+h ,jG Bv3@w+X 
w 
02L
2+Z v  Bx 
9+` w  Bv w  Dw  v,jG Bv+U3B+h w  Bv w  Dw3B
2+f +f 
93B+h Dy 
93B+
j3@|+
  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bw y 
2,j<  x,jI w,j|  x,jI 
1,j| 
7,j| Bw6
)0V+
  ~,k+
  
6,j>  
6,jm,jG  
5,jm  
5,jm  
4,jm  
4 
3,jf Bw y 
2,j<  x,jI w,j|  x,jI 
1,j| 
7,j| ~ B8  
1,j>  
0 
0,s% 

9 L{+
j {3B+
 
9+
(6
+0V+
  } ~,j< B} ~  D~+
c ~  B~2B+
c3@}+
( }  B| }  D} B~+
  >t,~<<w<w<}<v<<u<v<0<t<u<q<
X<<<<r<<
P<
2<
4<
<WRTUNTMODA WRITE to UNIT 5 was modified to (UNIT=%p).%pMS5TEG> Bx D   B D~  B~6U0V+u @} @} @| B} 
9 B| },jG @| 
    B{ D{ Fz Hz Jy 
| Ly2@{+
R +V {  Bx {  D{    Bx Dx Fw Hw   Bv Dv Dv  Bu3B+
^ +
_ 
92B+
b 
96U1V+
b 3B+&  Bu  Dv3Bf+
g +
h 
93B+&  Bu  Dv3Be+
m +
m 
93B+& ,jG Bu3@v+
v6V0V+ Bu Dt Du  Bt3B+
y +
y 
92B+
} 
96V1V+
} 3B+ Dt3Be+
93B+t  Dt3Bd+
93B++ Dt   Bt Ds Dt  Bs3B+
92B+
96W1V+ Ds3Bd+
93B++ Ds   Bs Dr Ds  Br3B+
92B+
96X1V+ Dr3Bc+
93B++ Dr   Br Dq Dr  Bq3B+
92B+
96X1V+ Dq3Bc+
93B++ Dq   Bq Dp Dq  Bp3B+
92B+
96Y1V+ Dp   Bp Do Dp  Bo3B+
92B+
96Y1V+ Do3Bb+
93B+o  Do  b,jT3B+
93@o++
93@p++
93@q++
93@r++
93@s++
93@t++w 
9+ v  Bu v  Dv  u,jG Bu+
p3B+&6Z0V+ v  Bu v  Dv   Bu Du Du  Bt3B+ + 
92B+ 
96Z1V+ 3B+  Bt  Du3Be+ + 
93B+  Bt  Du3Bd+ + 
93B+6W0V+
  Bt  Du   Bt Dt Dt  Bs3B+' +( 
92B++ 
96[1V++D3B+ +1 
93B++	  Bs  Dt   Bs Ds Ds  Br3B+; +; 
92B+? 
96[1V+? 3B+
  Br  Ds3Bc+D +D 
93B+
6W0V+  Br  Ds   Br Dr Dr  Bq3B+N +O 
92B+R 
96\1V+R 3B+  Bq  Dr3Bc+W +X 
93B+6W0V+  Bq  Dr   Bq Dq Dq  Bp3B+b +b 
92B+f 
96\1V+f 3B+6W0V+  Bp  Dq   Bp Dp Dp  Bo3B+p +p 
92B+t 
96]1V+t 3B+  Bo  Dp3Bb+y +y 
93B+  Bo  Dp  b,jT3B+ 
93@p+ 3B+ 
93@q+ 3B+ 
93@r+ 3B+
 
93@s+
 3B+
93@t++ 
93@u+ 3B+& ,jG Bu3@v+ 
v 
02La+ u  Bw 
9+ v  Bu v  Dv  u,jG Bu+3B+& v  Bu v  Dv3Ba+# +$ 
93B+& Dx 
93B+
P3@|+>  a,j>  b,jm,jG  c,jm  c,jm  d,jm  d e,jf Bv x a,j<  w,jI v,j|  w,jI e,j| f,j| Bv6U0V+Q  ~,k+Q  a,j>  b,jm,jG  c,jm  c,jm  d,jm  d e,jf Bv x a,j<  w,jI v,j|  w,jI e,j| f,j| ~ B8  `,j>  ` _,s% 

9 L{+
P {3B+X 
9+u ~  B},jG @|