Trailing-Edge
-
PDP-10 Archives
-
BB-KL11J-BM_1990
-
t20sub/edthelp.hlb
There are 23 other files named edthelp.hlb in the archive. Click here to see a list.
@$"y
@EDTAPATCH:<AUTOPATCH>EDTHLP.MEM.1"y
\0+(i[,@,PJ,`,p=f0(+0@+!0`+O1`02062(1212x4 3(5! 3H5l3P603h6b3X6W3x6p4747/47L4I84(8488N4H904X9H4`: 4h:4x:)5:^5;5`<x
; KL;(KX;0Km;8LB;HLg;XL{;`M$;pM=<M_<N < N#<0N6<@NE:hJ+<PNW<`Nd<hO<xO$=O9=Oh= P
=0P)=8PD=XQ'=pQ7>Qp>QB>(Rc>8Ru'b'|' '( '0 %'8 ^'@ y'H
'P
''X
@'`
v'h
'p%'x+(E(N(W(p(
&((
=(0
V%Xp%`%h9%p%x@&f&&)&Z&&(<&0h&8p&@"&H+&P4&X>&`H&h*P3*XM*`V*h*p *x!+X+q+ (@(H%(PN(X0(`U(h(p&(xG)))8)Q) Y)()0)81)@S)H~)PB)X+8+P{+x<,w+XB,=+h`,0o, ]+H0*
-q- - ,-( `-0!-8!
-@!S-H!h-P!}-X"-`"/-h"a-p#-x#0.#@.#W.#m. $.($.0$-.8$P.@$p.H%5.P%z.X&I.h&^.p&v.x'/'/'7/'T/(($/ (/0(5/8(T/@)/H)2/P)E/`)Y/h)l/p)x0*18- 0h+l1,*'1P.e1H-h6(?8PE#8@Dt88Db8`E68 D?8D/80DO9PGN9Fk9XGc9@G=90G/9G9(G"10-1,R1 -HELPKEYPADVT100127300301302303304305306307308309310311312313314315316317318319320321001004005008009010011012018020021023026065068069082084085087090VT52127300301302303304305306307308309310311312313314315316320321001004005006008009010011012018020021023026065068069070082084085087090CHANGEENTITIESCHARACTERWORDLINERANGESENTENCEPAGEPARAGRAPHSELECTVERTICALSTRINGHARDCOPYKEYPADSCREENSUBCOMMANDSADVAPPENDASCBACKBELLCHGCCHGLCHGUCLSSCUTDDATEDEFKDESELDLWCDMOVDUPCEXITEXTFILLHELPIKSMOVEPASTEQUITRREFSSELSHIFTSSELSNTABTADJTCTDTGSELTITOPUNDELETE()^CLEARCOPY/DUPLICATE/QUERYDEFINEKEYKEY-SELECTORSTRINGQUERYRESETGOLDEXAMPLESVT52VT100MACRODELETE/QUERYEXIT/SAVE/GOFILLFINDINCLUDEINSERTJOURNALMOVE/QUERYPRINTPUSHQUIT/SAVERANGEALLANDBEGINBEFOREBUFFERDOTENDFORLASTMINUSNUMBERORIGINALPLUSRESTSELECTSTRINGTHRUWHOLEREPLACERECOGNITIONRESEQUENCE/SEQUENCESETAUTOREPEATCASECOMMANDSTARTUPCONTROL-TCURSORENTITYFNFHELPKEYPADLINESMODENUMBERSPARAGRAPHPROMPTQUIETREPEATSCREENSEARCHGENERALEXACTWPSCIBOUNDEDBEGINENDSUMMARYTABTERMINALHCPYVT100VT52SCROLLNOSCROLLEDITNOEDITTEXTTRUNCATEVERIFYWORDWRAPSHOWAUTOREPEATBUFFERCASECOMMANDSHOWCURSORENTITYFILESFNFHELPKEYKEYPADLINESMODENUMBERSPARAGRAPHPROMPTQUIETREPEATSCREENSEARCHSUMMARYTABTERMINALTEXTTRUNCATEVERIFYVERSIONWORDWRAPSUBSTITUTE/BRIEF[:N]/NOTYPENEXT/QUERYTABTYPE/BRIEF/STAYWRITE
You can get help on a topic by typing:
HELP topic subtopic subsubtopic...
Where the topic and subtopics are alphanumeric strings.
Examples: HELP SUBSTITUTE NEXT
HELP CHANGE SUBCOMMAND
HELP CHA
Enter the keypad editor through the CHANGE command with the keypad option set
(see SET command). See HELP CHANGE KEYPAD for more information.
[1;24r[H[J)0lqqqqqqqqwqqqqqqqqwqqqqqqqqwqqqqqqqqk lqqqqqqqqwqqqqqqqqwqqqqqqqqwqqqqqqqqk
x ^ x DOWN x x x x[7m [mx x FNDNXT x DEL L x
x x x x x <qqqq x qqqq> x x[7m GOLD [mx HELP x x x
x x x x x LEFT x RIGHT x x[7m [mx x[7m FIND [mx[7m UND L [mx
x UP x v x x x tqqqqqqqqnqqqqqqqqnqqqqqqqqnqqqqqqqqu
mqqqqqqqqvqqqqqqqqvqqqqqqqqvqqqqqqqqj x PAGE x SECT x APPEND x DEL W x
DELETE Delete character x x x x x
LINEFEED Delete to beginning of word x[7m COMMAND[mx[7m FILL [mx[7m REPLACE[mx[7m UND W [mx
BACKSPACE Backup to beginning of line tqqqqqqqqnqqqqqqqqnqqqqqqqqnqqqqqqqqu
CTRL/A Compute tab level x ADVANCEx BACKUP x CUT x DEL C x
CTRL/D Decrease tab level x x x x x
CTRL/E Increase tab level x[7m BOTTOM [mx[7m TOP [mx[7m PASTE [mx[7m UND C [mx
CTRL/K Define key tqqqqqqqqnqqqqqqqqnqqqqqqqqnqqqqqqqqu
CTRL/R Refresh screen x WORD x EOL x CHAR x x
CTRL/T Adjust tabs x x x x ENTER x
CTRL/U Delete to beginning of line x[7mCHNGCASE[mx[7m DEL EOL[mx[7m SPECINS[mx x
CTRL/W Refresh screen tqqqqqqqqvqqqqqqqqnqqqqqqqqu x
CTRL/Z Return to line mode x LINE x SELECT x x
x x x[7m SUBS [mx
[1mPress a key for help on that key.[m x[7m OPEN LINE [mx[7m RESET [mx x
[1mTo exit, press the spacebar.[m mqqqqqqqqqqqqqqqqqvqqqqqqqqvqqqqqqqqj[22H[K
[7mDELETE[m
Deletes the character preceding the cursor and stores it in the delete
character buffer. When the cursor is on the leftmost character position on a
line, the line terminator to the left is deleted and the text on that line is
moved to the right of the text in the line above.
[7mLINE - (0)[m
Moves the cursor forward or backward to the nearest beginning of a line,
depending on the current direction (see ADVANCE and BACKUP).
[7mOPEN LINE - (GOLD 0)[m
Inserts a carriage return/linefeed after the cursor and leaves the cursor
position unchanged. Pressing the OPEN LINE key when the cursor is at the
beginning of the line creates a new blank line.
[7mWORD - (1)[m
Moves the cursor forward or backward by a word, depending on the current
direction (see ADVANCE and BACKUP).
[7mCHNGCASE - (GOLD 1)[m
Changes the case of a range of characters as follows:
1. If the select range is active, the case of each alphabetic character
in the select range is changed.
2. If 1 does not apply and the cursor is positioned on the current
search string, the case of each alphabetic character in the search
string is changed. This does not apply if a repeat count greater
than 1 is given.
3. If 1 and 2 do not apply, then the case of one character is changed.
If the current direction is ADVANCE, then the cursor moves forward
one character after the change of case occurs. If the current
direction is BACKUP, then the cursor moves backward one character
before the case change occurs.
[7mEOL - (2)[m
Moves the cursor forward or backward to the nearest end of line, depending on
current direction (see ADVANCE and BACKUP).
[7mDEL EOL - (GOLD 2)[m
Deletes all characters to the right of the cursor in the current line,
including the character on which the cursor is positioned, up to, but not
including the line terminator.
[7mCHAR - (3)[m
Moves the cursor forward or backward one character, depending on the current
direction (see ADVANCE and BACKUP).
[7mSPECINS - (GOLD 3)[m
Inserts any ASCII character by using its decimal value. Press the GOLD key,
enter the decimal representation of the character, press the GOLD key again,
and press SPECINS (special insert).
[7mADVANCE - (4)[m
Sets the current direction to forward for the CHAR, WORD, LINE, EOL, PAGE,
SECT, SUBS, FIND, and FNDNXT keys. ADVANCE means that movement will be toward
the end of the buffer; that is, to the right and down.
[7mBOTTOM - (GOLD 4)[m
Positions the cursor at the end of the text buffer.
[7mBACKUP - (5)[m
Sets the cursor direction to backward for the CHAR, WORD, LINE, EOL, PAGE,
SECT, SUBS, FIND, and FNDNXT keys. BACKUP means that movement will be toward
the beginning of the buffer; that is, to the left and up.
[7mTOP - (GOLD 5)[m
Positions the cursor at the beginning of the text buffer.
[7mCUT - (6)[m
Moves the select range to the PASTE buffer. The select range is all the text
between the selected position (see SELECT) and the current cursor position.
If no SELECT has been made and the cursor is positioned on the current search
string, that string is cut. Each time CUT is used, the previous contents of
the PASTE buffer are discarded.
[7mPASTE - (GOLD 6)[m
Inserts the contents of the PASTE buffer directly in front of the cursor.
[7mPAGE - (7)[m
Moves the cursor to the top of a page. A page is defined by a delimiter
string, which can be set by the SET ENTITY command. The default page
delimiter is the formfeed character (CTRL/L).
[7mCOMMAND - (GOLD 7)[m
Allows you to input a line mode command to be executed. The command is
processed when you press the ENTER key on the keypad.
[7mSECT - (8)[m
Moves the cursor 16 lines (one section) forward or backward, depending on the
current direction (see ADVANCE and BACKUP).
[7mFILL - (GOLD 8)[m
Performs a word fill on the select range. A word fill reformats a block of
text so that as many full words as possible are placed on each line without
exceeding the right margin. You can set the right margin with the SET WRAP
command. If it is not set, the default is the terminal width - 1. For
purposes of the FILL command, only spaces are used as word delimiters.
[7mAPPEND - (9)[m
Moves the select range to the end of the PASTE buffer. The select range is
all the text between the selected position (see SELECT) and the current cursor
position. If no SELECT has been made and the cursor is positioned on the
current search string, that string is appended.
[7mREPLACE - (GOLD 9)[m
Deletes the select range and replaces it with the contents of the PASTE
buffer.
[7mHELP - (PF2)[m
Use the HELP key to obtain help on the editing keypad.
[7mFNDNXT - (PF3)[m
Searches for the next occurrence of the search string previously entered by
the FIND key. The direction of the search is the current one (ADVANCE or
BACKUP).
[7mFIND - (GOLD PF3)[m
Searches for an occurrence of a string. Press the FIND key and then enter the
string from the main keyboard. End the string by pressing either the ADVANCE
or BACKUP key to set the direction of the search, or the ENTER key to search
in the current direction.
[7mUP-ARROW[m
The ^ (up-arrow) key moves the cursor to the character above.
[7mDOWN-ARROW[m
The v (down-arrow) key moves the cursor to the character below.
[7mRIGHT-ARROW[m
The --> (right-arrow) key moves the cursor to the next character.
[7mLEFT-ARROW[m
The <-- (left-arrow) key moves the cursor to the preceding character.
[7mSELECT - (.)[m
Marks one end of a select range. A select range is a block of text on which
various operations (such as CUT, APPEND, or FILL) can be performed. To create
a select range, you:
1. Move the cursor to either the beginning or end of the text you wish
to select.
2. Press the SELECT key.
3. Move the cursor to the opposite end of the text.
You can then perform the desired operation on the range.
[7mRESET - (GOLD .)[m
Cancels the effect of the GOLD key if it was pressed by mistake, cancels a
select range, or cancels any partially-entered command string. Also sets the
current direction to forward.
[7mDEL L - (PF4)[m
Deletes text from the cursor position to the end of the current line,
including the line terminator. If the cursor is positioned at the beginning
of a line, the entire line is deleted. The deleted text is saved in the
delete line buffer.
[7mUND L - (GOLD PF4)[m
Inserts the contents of the delete line buffer directly in front of the
cursor.
[7mDEL W - (-)[m
Deletes text from the cursor to the beginning of the next word, storing the
text in the delete word buffer.
[7mUND W - (GOLD -)[m
Inserts the contents of the delete word buffer directly in front of the
cursor.
[7mDEL C - (,)[m
Deletes the character on which the cursor is positioned and saves it in the
delete character buffer.
[7mUND C - (GOLD ,)[m
Inserts the contents of the delete character buffer directly in front of the
cursor.
[7mGOLD - (PF1)[m
Lets you use the lower function of the editing keys. Press the GOLD key, then
the key you wish to use.
You can also use the GOLD key to enter counts. Press GOLD and then the main
keyboard numeric keys, followed by the key to which the count should apply.
The DELETE key and CTRL/U can be used to edit the count, and thus cannot have
a count applied to them. The count can be a repeat-count, a level-count, or
the code for a character, depending on the terminating key.
For help on "GOLD letter" (for example, GOLD A), press the alphabetic key on
the main keyboard.
[7mENTER[m
Processes the command that was just given.
[7mSUBS - (GOLD ENTER)[m
Deletes the search string, replaces it with the contents of the PASTE buffer,
and finds the next occurrence of the string. For multiple substitutions, you:
1. Press SELECT.
2. Type the new text.
3. Press CUT.
4. Press FIND.
5. Enter the text you wish to replace.
Each time you press SUBS, EDT makes one substitution and finds the next
occurrence of the search string. You can use a repeat count for multiple
substitutions.
[7mTAB COMPUTE - (CTRL/A)[m
Sets the indentation level count to the value obtained from dividing the
current cursor column position by the SET TAB number. If the cursor position
is not a multiple of the SET TAB number, an error results.
[7mTAB DECREASE - (CTRL/D)[m
Used to decrease the indentation level counter.
[7mTAB INCREASE - (CTRL/E)[m
Used to increase the indentation level counter.
[7mBEGINNING OF LINE - (CTRL/H or BACKSPACE)[m
Moves the cursor to the beginning of the current line. If the cursor is
already on the beginning of a line, it moves to the beginning of the previous
line.
[7mTAB INSERT - (CTRL/I or TAB)[m
Moves the cursor in one of two ways:
1. If the tab size has not been set with SET TAB or if the cursor is not
at the beginning of the line, a tab character is inserted at the
cursor position.
2. If the tab size has been set with SET TAB or if the cursor is at the
beginning of the line, a number of tab characters and spaces are
inserted to move the cursor to the column position that is equal to
the SET TAB value times the indentation level count.
[7mDELETE TO BEGINNING OF WORD - (CTRL/J or LINEFEED)[m
Used to delete all characters from the cursor position to the beginning of the
word containing the cursor. If the cursor is on the first character of a
word, the previous word is deleted.
[7mDEFINE KEY - (CTRL/K)[m
Used to define a new function for an editing key. You are prompted first to
press the key to be defined, then to enter the definition. You can define the
key either in terms of other editing keys or with change mode subcommands. If
you use an editing key, its definition appears at the bottom of the screen.
[7mINSERT FORMFEED - (CTRL/L)[m
Inserts a formfeed character (<FF>) at the cursor position.
[7mREFRESH - (CTRL/R)[m
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
[7mTAB ADJUST - (CTRL/T)[m
Adjusts the tab level of the select range. To use the key, you:
1. Create a select range of the text you wish to adjust.
2. Enter a level count using the GOLD key. To decrease the tab
indentation level, precede the count with a minus sign. The default
level count is 1.
3. Use the tab adjust key.
The effect of CTRL/T is to increase or decrease the indentation level of the
select range by the number of tabs specified in the level count.
[7mDELETE TO BEGINNING OF LINE - (CTRL/U)[m
Used to delete all characters in the current line to the left of the cursor.
If the cursor is on the first character of a line, the entire previous line is
deleted.
[7mREFRESH - (CTRL/W)[m
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
[7mEXIT - (CTRL/Z)[m
Returns you to line editing.
[7mTAB COMPUTE - (GOLD A)[m
Sets the indentation level count to the value obtained from dividing the
current cursor column position by the SET TAB number. If the cursor position
is not a multiple of the SET TAB number, an error results.
[7mTAB DECREASE - (GOLD D)[m
Used to decrease the indentation level counter.
[7mTAB INCREASE - (GOLD E)[m
Used to increase the indentation level counter.
[7mREFRESH - (GOLD R)[m
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
[7mTAB ADJUST - (GOLD T)[m
Adjusts the tab level of the select range. To use the key, you:
1. Create a select range of the text you wish to adjust.
2. Enter a level count using the GOLD key. To decrease the tab
indentation level, precede the count with a minus sign. The default
level count is 1.
3. Use the tab adjust key.
The effect of GOLD T is to increase or decrease the indentation level of the
select range by the number of tabs specified in the level count.
[7mDELETE TO BEGINNING OF LINE - (GOLD U)[m
Used to delete all characters in the current line to the left of the cursor.
If the cursor is on the first character of a line, the entire previous line is
deleted.
[7mREFRESH - (GOLD W)[m
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
[7mEXIT - (GOLD Z)[m
Returns you to line editing.
+--------+--------+--------+--------+
| | | DEL L | UP |
DELETE Delete character | GOLD | HELP | | |
LINEFEED Delete to beginning of word | | | UND L |REPLACE |
BACKSPACE Backup to beginning of line +--------+--------+--------+--------+
| PAGE | FNDNXT | DEL W | DOWN |
CTRL/A Compute tab level | | | | |
CTRL/D Decrease tab level |COMMAND | FIND | UND W | SECT |
CTRL/E Increase tab level +--------+--------+--------+--------+
CTRL/F Fill text |ADVANCE | BACKUP | DEL C | RIGHT |
CTRL/K Define key | | | | |
CTRL/R Refresh screen | BOTTOM | TOP | UND C |SPECINS |
CTRL/T Adjust tabs +--------+--------+--------+--------+
CTRL/U Delete to beginning of line | WORD | EOL | CUT | LEFT |
CTRL/W Refresh screen | | | | |
CTRL/Z Return to line mode |CHNGCASE|DEL EOL | PASTE | APPEND |
+--------+--------+--------+--------+
| LINE | SELECT | ENTER |
| | | |
| OPEN LINE | RESET | SUBS |
*** For help on a key, press the key. +-----------------+--------+--------+
*** To exit, press the spacebar.
DELETE
------
Deletes the character preceding the cursor and stores it in the delete
character buffer. When the cursor is on the leftmost character position on a
line, the line terminator to the left is deleted and the text on that line is
moved to the right of the text in the line above.
LINE (0)
----
Moves the cursor forward or backward to the nearest beginning of a line,
depending on the current direction (see ADVANCE and BACKUP).
OPEN LINE (GOLD 0)
---------
Inserts a carriage return/linefeed after the cursor and leaves the cursor
position unchanged. Pressing the OPEN LINE key when the cursor is at the
beginning of the line creates a new blank line.
WORD (1)
----
Moves the cursor forward or backward by a word, depending on the current
direction (see ADVANCE and BACKUP).
CHNGCASE (GOLD 1)
--------
Changes the case of a range of characters as follows:
1. If the select range is active, the case of each alphabetic character
in the select range is changed.
2. If 1 does not apply and the cursor is positioned on the current
search string, the case of each alphabetic character in the search
string is changed. This does not apply if a repeat count greater
than 1 is given.
3. If 1 and 2 do not apply, then the case of one character is changed.
If the current direction is ADVANCE, then the cursor moves forward
one character after the change of case occurs. If the current
direction is BACKUP, then the cursor moves backward one character
before the case change occurs.
EOL (2)
---
Moves the cursor forward or backward to the nearest end of line, depending on
the current direction (see ADVANCE and BACKUP).
DEL EOL (GOLD 2)
-------
Deletes all characters to the right of the cursor in the current line,
including the character on which the cursor is positioned, up to, but not
including the line terminator.
CUT (3)
---
Moves the select range to the PASTE buffer. The select range is all the text
between the selected position (see SELECT) and the current cursor position.
If no SELECT has been made and the cursor is positioned on the current search
string, that string is cut. Each time CUT is used, the previous contents of
the PASTE buffer are discarded.
PASTE (GOLD 3)
-----
Inserts the contents of the PASTE buffer directly in front of the cursor.
ADVANCE (4)
-------
Sets the current direction to forward for the CHAR, WORD, LINE, EOL, PAGE,
SECT, SUBS, FIND, and FNDNXT keys. ADVANCE means that movement will be toward
the end of the buffer; that is, to the right and down.
BOTTOM (GOLD 4)
------
Positions the cursor at the end of the text buffer.
BACKUP (5)
------
Sets the cursor direction to backward for the CHAR, WORD, LINE, EOL, PAGE,
SECT, SUBS, FIND, and FNDNXT keys. BACKUP means that movement will be toward
the beginning of the buffer; that is, to the left and up.
TOP (GOLD 5)
---
Positions the cursor at the beginning of the text buffer.
DEL C (6)
-----
Deletes the character on which the cursor is positioned and saves it in the
delete character buffer.
UND C (GOLD 6)
-----
Inserts the contents of the delete character buffer directly in front of the
cursor.
PAGE (7)
----
Moves the cursor to the top of a page. A page is defined by a delimiter
string, which can be set by the SET ENTITY command. The default page
delimiter is the formfeed character (CTRL/L).
COMMAND (GOLD 7)
-------
Allows you to input a line mode command to be executed. The command is
processed when you press the ENTER key on the keypad.
FNDNXT (8)
------
Searches for the next occurrence of the search string previously entered by
the FIND key. The direction of the search is the current one (ADVANCE or
BACKUP).
FIND (GOLD 8)
----
Searches for an occurrence of a string. Press the FIND key and then enter the
string from the main keyboard. End the string by pressing either the ADVANCE
or BACKUP key to set the direction of the search, or the ENTER key to search
in the current direction.
DEL W (9)
-----
Deletes text from the cursor to the beginning of the next word, storing the
text in the delete word buffer.
UND W (GOLD 9)
-----
Inserts the contents of the delete word buffer directly in front of the
cursor.
HELP (RED)
----
Use the HELP key to obtain help on the editing keypad.
DEL L (GRAY)
-----
Deletes text from the cursor position to the end of the current line,
including the line terminator. If the cursor is positioned at the beginning
of a line, the entire line is deleted. The deleted text is saved in the
delete line buffer.
UND L (GOLD GRAY)
-----
Inserts the contents of the delete line buffer directly in front of the
cursor.
UP (UP-ARROW)
--
The ^ (up-arrow) key moves the cursor to the character above.
REPLACE (GOLD UP-ARROW)
-------
Deletes the select range and replaces it with the contents of the PASTE
buffer.
DOWN (DOWN-ARROW)
----
The v (down-arrow) key moves the cursor to the character below.
SECT (GOLD DOWN-ARROW)
----
Moves the cursor 16 lines (one section) forward or backward, depending on the
current direction (see ADVANCE and BACKUP).
RIGHT (RIGHT-ARROW)
-----
The --> (right-arrow) key moves the cursor to the next character.
SPECINS (GOLD RIGHT-ARROW)
-------
Inserts any ASCII character by using its decimal value. Press the GOLD key,
enter the decimal representation of the character, press the GOLD key again,
and press SPECINS (special insert).
LEFT (LEFT-ARROW)
----
The <-- (left-arrow) key moves the cursor to the preceding character.
APPEND (GOLD LEFT-ARROW)
------
Moves the select range to the end of the PASTE buffer. The select range is
all the text between the selected position (see SELECT) and the current cursor
position. If no SELECT has been made and the cursor is positioned on the
current search string, that string is appended.
SELECT (.)
------
Marks one end of a select range. A select range is a block of text on which
various operations (such as CUT, APPEND, or FILL) can be performed. To create
a select range, you:
1. Move the cursor to either the beginning or end of the text you wish
to select.
2. Press the SELECT key.
3. Move the cursor to the opposite end of the text.
You can then perform the desired operation on the range.
RESET (GOLD .)
-----
Cancels the effect of the GOLD key if it was pressed by mistake, cancels a
select range, or cancels any partially-entered command string. Also sets the
current direction to forward.
GOLD (BLUE)
----
Lets you use the lower function of the editing keys. Press the GOLD key, then
the key you wish to use.
You can also use the GOLD key to enter counts. Press GOLD and then the main
keyboard numeric keys, followed by the key to which the count should apply.
The DELETE key and CTRL/U can be used to edit the count, and thus cannot have
a count applied to them manner. The count can be a repeat-count, a
level-count, or the code for a character, depending on the terminating key.
For help on "GOLD letter" (for example, GOLD A), press the alphabetic key on
the main keyboard.
ENTER
-----
Processes the command that was just given.
SUBS (GOLD ENTER)
----
Deletes the search string, replaces it with the contents of the PASTE buffer,
and finds the next occurrence of the string. For multiple substitutions, you:
1. Press SELECT.
2. Type the new text.
3. Press CUT.
4. Press FIND.
5. Enter the text you wish to replace.
Each time you press SUBS, EDT makes one substitution and finds the next
occurrence of the search string. You can use a repeat count for multiple
substitutions.
TAB COMPUTE (CTRL/A)
-----------
Sets the indentation level count to the value obtained from dividing the
current cursor column position by the SET TAB number. If the cursor position
is not a multiple of the SET TAB number, an error results.
TAB DECREASE (CTRL/D)
------------
Used to decrease the indentation level counter.
TAB INCREASE (CTRL/E)
------------
Used to increase the indentation level counter.
FILL (CTRL/F)
----
Performs a word fill on the select range. A word fill reformats a block of
text so that as many full words as possible are placed on each line without
exceeding the right margin. You can set the right margin with the SET WRAP
command. If it is not set, the default is the terminal width - 1. For
purposes of the FILL command, only spaces are used as word delimiters.
BEGINNING OF LINE (CTRL/H or BACKSPACE)
-----------------
Moves the cursor to the beginning of the current line. If the cursor is
already on the beginning of a line, it moves to the beginning of the previous
line.
TAB INSERT (CTRL/I or TAB)
----------
Moves the cursor in one of two ways:
1. If the tab size has not been set with SET TAB or if the cursor is not
at the beginning of the line, a tab character is inserted at the
cursor position.
2. If the tab size has been set with SET TAB or if the cursor is at the
beginning of the line, a number of tab characters and spaces are
inserted to move the cursor to the column position that is equal to
the SET TAB value times the indentation level count.
DELETE TO BEGINNING OF LINE (CTRL/J or LINEFEED)
---------------------------
Used to delete all characters from the cursor position to the beginning of the
word containing the cursor. If the cursor is on the first character of a word
the previous word is deleted.
DEFINE KEY (CTRL/K)
----------
Used to define a new function for an editing key. You are prompted first to
press the key to be defined, then to enter the definition. You can define the
key either in terms of other editing keys or with change mode subcommands.
When you use an editing key, its definition appears at the bottom of the
screen.
INSERT FORMFEED (CTRL/L)
----------------
Inserts a formfeed character (<FF>) at the cursor position.
REFRESH (CTRL/R)
-------
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
TAB ADJUST (CTRL/T)
----------
Adjusts the tab level of the select range. To use the key, you:
1. Create a select range of the text you wish to adjust.
2. Enter a level count using the GOLD key. To decrease the tab
indentation level, precede the count with a minus sign. The default
level count is 1.
3. Use the tab adjust key.
The effect of CTRL/T is to increase or decrease the indentation level of the
select range by the number of tabs indicated by the level count.
DELETE TO BEGINNING OF LINE (CTRL/U)
---------------------------
Used to delete all characters in the current line to the left of the cursor.
If the cursor is on the first character of a line, the entire previous line is
deleted.
REFRESH (CTRL/W)
-------
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
EXIT (CTRL/Z)
----
Returns you to line editing.
TAB COMPUTE (GOLD A)
-----------
Sets the indentation level count to the value obtained from dividing the
current cursor column position by the SET TAB number. If the cursor position
is not a multiple of the SET TAB number, an error results.
TAB DECREASE (GOLD D)
------------
Used to decrease the indentation level counter.
TAB INCREASE (GOLD E)
------------
Used to increase the indentation level counter.
FILL (GOLD F)
----
Performs a word fill on the select range. A word fill reformats a block of
text so that as many full words as possible are placed on each line without
exceeding the right margin. The right margin can be set by the SET WRAP
command. If it is not set, the default is the terminal width - 1. For
purposes of the FILL command, only spaces are used as word delimiters.
REFRESH (GOLD R)
-------
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
TAB ADJUST (GOLD T)
----------
Adjusts the tab level of the select range. The key is used as follows:
1. Create a select range of the text you wish to adjust.
2. Enter a level count using the GOLD key. To decrease the tab
indentation level, precede the count with a minus sign. The default
level count is 1.
3. Use the tab adjust key.
The effect of GOLD T is to increase or decrease the indentation level of the
select range by the number of tabs indicated by the level count.
DELETE TO BEGINNING OF LINE (GOLD U)
---------------------------
Used to delete all characters in the current line to the left of the cursor.
If the cursor is on the first character of a line, the entire previous line is
deleted.
REFRESH (GOLD W)
-------
Refreshes the screen display. The screen becomes blank and then the
characters in the buffer reappear, minus extraneous characters, such as system
messages. The cursor remains in the same location.
EXIT (GOLD Z)
----
Returns you to line editing.
The CHANGE command (abbreviated C) puts EDT in change mode. Use change mode
to edit at the character level rather than the line level.
Format: CHANGE [range] [\nokeypad commands]
The optional range specifies the cursor position when you enter change mode.
If you omit range, the current position is used.
There are three submodes of change mode. Which submode you use depends on the
type of terminal you are using and whether or not you wish to use the
auxiliary (numeric) keypad for editing commands. These modes are:
1. Hardcopy mode
2. Keypad mode
3. Nokeypad mode
If the command contains a backslash (\) it may be followed by nokeypad
commands. If the last nokeypad command is EX, EDT returns to line mode for
the next command line. This is the only form of the CHANGE command that may
be used in a startup file or macro.
Entities are used in change mode subcommands to specify the text on which a
subcommand will operate. Each entity represents a portion of text, which may
be anything from a single character to an entire text buffer. Most entities
can be preceded by a count, which indicates the number of entities to be
affected.
The character entity is specified by the letter C. It selects a single
character of text.
A word consists of a string of characters terminated by one of a set of
delimiter characters. The default delimiter characters are spaces, tabs,
carriage returns, line feeds, formfeeds, and vertical tabs. Spaces are
handled in a special way: all spaces following a word up to the first
non-space character are considered part of a word. Other delimiters are not
considered part of the word they terminate. Rather, they are considered to be
words by themselves, unless NODELIMITERS has been set. If NODELIMTERS is set,
delimiters are not considered words by themselves but are considered part of
the word they terminate. The three word entities are:
W Specifies the entire word in which the cursor is positioned.
BW Specifies all characters preceding the cursor up to the beginning of
the word.
EW Specifies all characters from the cursor through the end of the word.
You can change the word delimiters with the SET ENTITY command.
The line entities are:
L Specifies the entire line in which the cursor is positioned.
BL Specifies all characters preceding the cursor up to the beginning of a
line. (When the cursor is positioned at the beginning of a line, the
BL entity selects the entire previous line.)
EL Specifies all characters from the cursor to the end of a line,
including the character on which the cursor is positioned. (If the
cursor is on a line terminator, the entire next line is selected.)
NL Specifies all characters from the cursor to the beginning of the next
line, including the character on which the cursor is positioned.
The range entities specify all text in the buffer either before or after the
cursor. The two range entities are:
BR Specifies the text from the cursor position to the beginning of the
buffer.
ER Specifies the text from the cursor position to the end of the buffer.
A sentence consists of a string of characters terminated by one of a set of
single character delimiters. The default sentence delimiters are: period
(.), question mark (?), and exclamation point (!). A sentence delimiter is
considered to be a delimiter only if it is at the end of a line or if it is
followed by a space. The line terminator or trailing spaces are considered a
part of the sentence. There are three sentence entities:
SEN Specifies the entire sentence in which the cursor is positioned,
including the delimiter and trailing spaces or line terminator.
BSEN Specifies all characters preceding the cursor in the current
sentence.
ESEN Specifies all characters in the current sentence from the cursor to
(but not including) the delimiter character.
The sentence delimiters can be changed by the SET ENTITY command.
A page consists of all the text between two page delimiters, including the
trailing page delimiter. The default page delimiter is the formfeed
character. The three page entities are:
PAGE Specifies all of the current page.
BPAGE Specifies all characters in the current page from the character
preceding the cursor to the beginning of the page.
EPAGE Specifies all characters in the current page from the cursor to (but
not including) the page delimiter.
You can change the page delimiter with the SET ENTITY command.
A paragraph consists of all the text between two paragraph delimiters,
including the trailing paragraph delimiter, and if WPS is set, any adjacent
delimiters. The default paragraph delimiter is two consecutive line
terminators. The three paragraph entities are:
PAR Specifies all of the current paragraph.
BPAR Specifies all characters in the current paragraph from the character
preceding the cursor to the beginning of the paragraph.
EPAR Specifies all characters in the current paragraph from the cursor to
(but not including) the paragraph delimiter.
You can change the paragraph delimiter with the SET ENTITY command.
The select entity consists of all characters between the cursor and the select
mark. The select mark must have been specified previously by a SEL
subcommand. The select range entity is specified by SR. Some commands use
the search string when SR is used and no select mark has been specified.
The vertical line entity is the same as the line entity, except that with the
V entity, the cursor stays in the same column. You specify the vertical
entity with V.
The string entity consists of all the characters between the cursor and the
next occurrence of a specified search string. Specify the string entity by
enclosing the desired search string in single or double quotes. If the string
is null (specified by '' or ""), the previous search string is used again.
For key definitions, you may use the null character (ASCII character 0) in
place of the quotes to avoid conflicts with the search string.
On a hardcopy terminal, change mode operates like this:
When you enter change mode, EDT displays the current line on the terminal.
The cursor position is marked by bracketing the character on which the cursor
is positioned. EDT will then prompt with the characters:
C*
In response, you type a series of change mode subcommands terminated by a
carrige return. EDT will execute the commands and retype the line.
You enter the keypad submode of change mode when your terminal is a VT100 or
VT52 and the keypad option is on. (This option is on by default for these
terminals.) In this submode, the terminal screen is used to view the text
buffer. Characters typed on the main keyboard are inserted into the buffer at
the cursor position. You enter editing commands by using keys on the
auxiliary keypad, function keys, or control keys on the main keyboard.
For more help on keypad mode, type CHANGE to enter that mode. Use the keypad
HELP facility as follows:
1. If your terminal is a VT100, press the keypad key marked PF2.
2. If your terminal is a VT52, press the red keypad key.
You enter the screen submode of change mode if your terminal is a VT100 or
VT52 and the SET NOKEYPAD command has been used to turn off the keypad option.
The screen is used as a window into the text buffer. You type change mode
commands at the keyboard; they echo on the bottom line of the screen. EDT
executes the commands and updates the text on the screen whenever you type a
carriage return.
When EDT is in change mode, it accepts a distinct set of commands called the
change mode subcommands. You may concatenate a string of subcommands with or
without spaces separating them.
Subcommands take one of the following forms, depending on the particular
command:
1. command
2. [+|-] [count] command
3. [+|-] [count] [command] [+|-] [count] [+|-] entity [=buffer]
Whenever a sign can appear in more than one place, the last sign specified
determines the direction.
The ADV command sets the cursor direction to advance. Many subcommands use
the current direction to determine whether entities to the left or to the
right of the cursor are to be affected. When the direction is advance,
subcommands affect the cursor character and characters to the right.
Format: ADV
The APPEND command works in the same way as the CUT command (see CUT) except
that it adds the new text to the end of the alternate buffer instead of
replacing its contents.
Format: [+|-] [count] APPEND [+|-] [count] [+|-] entity [=buffer]
The ASC subcommand inserts a specified ASCII character into the buffer at the
cursor position. Use the count field to indicate the decimal value of the
ASCII character you want to insert.
Format: [count] ASC
The ASC command is the only way to insert a carriage return into the middle of
a line of text; otherwise, insert commands always treat the carriage return
as a line terminator. The following command would insert a carriage return:
13ASC (13 is the ASCII code for carriage return)
The BACK command sets the cursor direction to backup. Many subcommands use
the current direction to determine whether entities to the left or to the
right of the cursor are to be affected. When the direction is backup,
subcommands affect characters to the left of the cursor.
Format: BACK
The BELL command rings the bell on the terminal. There is no effect on the
text buffer.
Format: BELL
The CHGC command changes the case of every alphabetic character in the
specified number of entities: lowercase characters become uppercase and
uppercase become lowercase.
Format: [+|-] [count] CHGC [+|-] [count] [+|-] entity
CHGCSR (change case of select region) works differently: If there is no
select range and the cursor is in the search string, CHGCSR changes the case
of every alphabetic character in the search string. If there is no select
range and the cursor is not in the search string, CHGCSR changes the case of
the character under the cursor, if it is alphabetic. If the [count] field is
two or more, CHGCSR ignores the search string condition.
The CHGL command forces every alphabetic character in the specified range to
lowercase.
Format: [+|-] [count] CHGL [+|-] [count] [+|-] entity
CHGLSR has the same special contingencies as CHGCSR.
The CHGU command forces every alphabetic character in the specified range to
uppercase.
Format: [+|-] [count] CHGU [+|-] [count] [+|-] entity
CHGUSR has the same special contingencies as CHGCSR.
The CLSS command clears the search string buffer.
Format: CLSS
The CUT command deletes a specified number of entities and saves all the
deleted text in an alternate text buffer. The command works exactly like the
DELETE command except that the text is saved.
Format: [+|-] [count] CUT [+|-] [count] [+|-] entity [=buffer]
If you do not specify a buffer, the buffer named PASTE is used.
Ex: CUTSR Cut the selected range
CUTPAGE Cut the current page of text
The D subcommand deletes a specified number of entities.
Format: [+|-] [repeat-count] D [+|-] [count] [+|-] entity
If the entity is C, W, BW, EW, L, BL, EL, or NL, the last entity deleted by
the command is saved in the delete buffer associated with the entity and can
be restored with the UNDELETE C, W, or L subcommand.
Ex: D15C Deletes 15 characters in the current direction.
DSR Deletes the select range.
DBR Deletes to the beginning of the buffer.
The DATE command inserts the current date and time string into the buffer at
the current cursor position.
The form of the string is: dd-Mmm-yyyy hh:mm:ss . Note the trailing space.
Before the tenth of the month the dd is a space followed by a single digit.
This command always uses the English abbreviations for month names.
Format: DATE
The DEFK command assigns new definitions to editing keys. You are prompted
first to press the key to be defined, then to enter the definition. You can
define the key either in terms of other editing keys or by use of change mode
subcommands. If you use a keypad or function key, its definition appears at
the bottom of the screen. You should only use this command in keypad change
mode.
Format: DEFK
The DESEL command cancels the current select range if one is active. If no
select range is active the command has no effect.
Format: DESEL
The DLWC command sets the default command to CHGL. With this as the default
command, a MOVE command moves the cursor the specified number of entities and
leaves each moved alphabetic character as lowercase.
Format: DLWC
The DMOV command returns the default command to MOVE. When the default
command is MOVE, a MOVE command moves the cursor the specified number of
entities and changes no text.
Format: DMOV
The DUPC command is used to set the default command to CHGU. With this as the
default command, a MOVE command moves the cursor the specified number of
entities and leaves each moved alphabetic character as uppercase.
Format: DUPC
The EXIT command exits change mode (not the editor). When the exit command is
executed you return to line mode.
Format: EX
The EXT command executes a line mode command while you are in change mode.
EDT interprets the remainder of the command line as a line mode command,
executes the command, and reenters change mode automatically.
Format: EXT line mode command
The FILL command reformats a block of text so that as many complete words as
possible are placed on each line without exceeding the right margin. It sets
the right margin to the terminal width minus 1 character by default. The
margin may be changed by the SET WRAP command.
Format: [+|-] [count] FILL [+|-] [count] [+|-] entity
The HELP command causes a diagram of keypad functions and CONTROL key
descriptions to appear on the screen. If executed in keypad change mode,
additional information can be obtained by pressing keypad or control keys; in
nokeypad mode, pressing any subsequent key returns you to editing mode.
The I command inserts new text into the buffer at the current cursor position.
Format: I text to be inserted ^Z
This command behaves differently in each mode:
1. In keypad mode, insert text by typing on the main keyboard; you do
not need to begin the insert with I or end it with ^Z.
2. In nokeypad mode, type I to begin inserting text. You can insert
text from the keyboard until you enter ^Z; you can enter one or more
lines of text.
3. In hardcopy mode, type I to begin inserting text. You can insert
text from the keyboard until you enter either a ^Z or a carriage
return.
The KS command modifies the cursor position after a PASTE command.
Format: KS
After a PASTE command, the cursor is on the character to the right of the
pasted text. If PASTE is followed by KS, however, the cursor moves to the
last pasted character if the current direction is advance and to the first
pasted character if the direction is backup. You should only use the KS
command immediately after a PASTE command.
Such cursor positioning affects a subsequent string search. KS is used in the
definition of the keypad SUBS function so that the character that follows the
pasted text in the current direction is included in the next string search.
The MOVE command moves the cursor a specified number of entities. If the
default command is lowercase, all alphabetic characters encountered are forced
to lowercase. If the default command is uppercase, all alphabetic characters
encountered are forced to uppercase. With the default command set to move, no
text is changed.
Format: [+|-] [count] [+|-] entity
If you use an explicit sign, the direction of the move is determined by that
sign (+ for forward, - for backward); otherwise, the current direction mode
(set by the ADV and BACK commands) is used to determine the direction.
Ex: +3W Moves the cursor 3 words forward.
L Moves the cursor 1 line in the current direction.
-PAGE Moves the cursor backward to a page mark.
The PASTE command copies the contents of an alternate buffer into the current
buffer at the cursor position.
Format: [count] PASTE [=buffer]
If you omit the buffer name, the PASTE buffer is used.
The QUIT subcommand leaves the editor without saving any text buffers. This
will cause you to lose any editing you have done in this session unless you
used the WRITE command to save the text before quitting.
Format: QUIT
The R(eplace) command has the same form as the D command. In nokeypad mode,
the R command will enter insert mode after the text is deleted.
Format: [+|-] [repeat-count] R [+|-] [count] [+|-] entity
The REF command refreshes the screen.
Format: REF
The S command replaces occurrences of one string of characters with another.
Format: [+|-] [count] S/string-1/string-2/
The slashes represent any non-alphanumeric character used to delimit the two
strings. S searches in the specified direction from the cursor and finds an
occurrence of string-1. It deletes string-1 and inserts string-2 in its
place.
The SEL command marks a portion of text that will be one end of a select
range. You create a select range by marking one end of the desired text
(either end will do), moving to the other end, and performing an operation on
the SR (select range) entity.
Format: SEL
Use the SHIFT LEFT and SHIFT RIGHT commands to alter the left margin when in
change mode. The left margin is the position of the first character in each
line on the screen. Normally, the left margin is 0, which means all
characters are displayed. If you use a SHR command, the left margin can be
changed by an integral number of tab stops (8 characters). If SHL is used
once, the first 8 columns will not be displayed on the screen. This shifts
the screen window horizontally.
Format: count SHL (Shift left by count tab stops)
count SHR (Shift right by count tab stops)
The SSEL command searches for the occurrence of a string and places the string
in the select range. The cursor remains at the far end of the string.
Format: SSEL"string"
The SN command performs a SUBSTITUTE command using the same search and
replacement strings as the previous SUBSTITUTE command.
Format: [+|-] [count] SN
Use the TAB subcommand when the structured tab feature is enabled. Insert the
correct number of tabs and blanks to position to the current tab level. When
structured tabs have not been enabled or the cursor is not at the beginning of
a line, this command inserts a tab character.
Format: TAB
The TADJ command adjusts the tab level for the selected range of text. The
tab size and level-count set the tab level (see TC). The tab level is
adjusted by the value of level-count; it is incremented for a positive
level-count and decremented for a negative level-count. A level-count not
preceded by + or - is assumed positive. The TADJ tab setting is the product
of the tab size and the indentation level.
Format: [+|-] [level-count] TADJ [+|-] [entity-count] [+|-] entity
Note that the + or - that precedes the level-count is not used to modify the
direction of entity selection. Its function in this command differs in this
way from all other commands taking the above format.
The TC subcommand computes the tab level from the current cursor position.
This command has meaning only if the structured tab feature has been enabled.
See the SET TAB command.
Format: TC
The TD subcommand decreases the tab level counter. This command has meaning
only when the structured tab feature has been enabled. See the SET TAB
command.
Format: TD
The TGSEL command allows you to toggle select. That is, when the select range
is active, TGSEL will cancel it, and where no select range is active, TGSEL
will enable it.
Format: TGSEL
The TI subcommand increases the tab level counter. This commmand has meaning
only when the structured tab feature has been enabled. See the SET TAB
command.
Format: TI
The TOP command forces the line on which the cursor is positioned to the top
of the screen.
Format: TOP
The UNDELETE commands restore the last entity deleted by a delete command.
Format: UNDC (undelete character)
UNDW (undelete word)
UNDL (undelete line)
A sequence of subcommands can also be enclosed in parentheses to form a single
unit. A numeric literal preceding the left parenthesis indicates the number
of times to repeat the entire sequence.
This command provides for the insertion of control characters in text. EDT
accepts a circumflex (^) followed by an alphabetic character and inserts the
corresponding control character in the text as a single character.
Format: [count]^[A..Z]
The CLEAR (abbreviated CL) command deletes all the text in a buffer.
Format: CLEAR buffer-name
All the text in the specified buffer is deleted. (Note that the argument is a
buffername, not a range specification: CLEAR PASTE is valid, while CLEAR
=PASTE and CLEAR BUFFER PASTE are not.)
The COPY (abbreviated CO) command copies text from one location to another
within a buffer or between buffers. When text is copied, the source text
remains intact.
Format: COPY [range-1] TO [range-2] [/QUERY] [/DUPLICATE:n]
The lines specified by range-1 are copied in front of the first line specified
by range-2. Either range defaults to the current line.
If the destination is not the current buffer, put the name of the receiving
buffer immediately after TO (=buffer). Give the full name of the buffer. To
copy text from an external file, see INCLUDE.
When you use the /DUPLICATE (abbreviated /D) qualifier, the lines specified by
range-1 are duplicated n times.
Format: /DUPLICATE:n
When you use the /QUERY (abbreviated /Q) qualifier, EDT prompts you with a
question mark (?) to verify each line to be copied.
Format: /QUERY
Responses are:
Y Yes, copy this line
N No, do not copy this line
Q Quit, do not copy any of the rest of the lines
A All, copy all the rest of the lines
The DEFINE command (abbreviated DEF) defines either editing keys for keypad
mode or macros for line mode.
The DEFINE KEY (abbreviated DEF K) command defines customized editing keypads
or extends the keypad now available by using additional control keys. It is
also used to define function keys, for terminals that have function keys.
Format: DEFINE KEY key-selector AS "string"
Format: DEFINE KEY key-selector AS "string"
Key-selector is one of the following
[GOLD] CONTROL letter
[GOLD] CONTROL "letter"
GOLD character
GOLD "character"
[GOLD] DELETE
Number refers to keypad and function keys and CONTROL letter names specific
control keys (upper- and lowercase letters are considered equivalent). DELETE
refers to the delete key, which is not a control character. Character refers
to any keyboard key except 0-9. Characters !, ?, ;, and " must be enclosed in
quotes, others may be. With " an extra quote is required, ie, """".
Format: DEFINE KEY key-selector AS "string"
The string is a string of change mode subcommands that define the function of
the key. If you want the command to be executed when the key is struck, the
definition must end with a period; otherwise, EDT will accumulate definitions
until the user types a key whose definition ends with a period, then execute
them all together.
You can use a question mark (?) or question mark and asterisk (?*), in key
definitions to request input from the user. The ? is then replaced by the
characters read from the terminal before the command is executed. A prompt
string enclosed in single quotes may follow the ?. A response to an input
request generated by a ? must be terminated by a keypad or function key,
whereas a response to a ?* may be terminated by a keypad key, a function key
or a carriage return.
If you define a key as "RESET" (must be exactly five characters) the key will
perform the reset keypad function. RESET is not a nokeypad command.
If you define a key as "GOLD" the key will perform the gold keypad function.
GOLD is not a nokeypad command.
To define the key CTRL/A to move 3 lines, use the following command:
DEFINE KEY CONTROL A AS "3L."
To define the GOLDed function of the up-arrow key to mean "go to top of
buffer," use the following command:
DEFINE KEY GOLD 12 AS "BR."
To define the key CTRL/D to write your COBOL identification division header
for you, use the following command:
DEFINE KEY CONTROL D AS "iIDENTIFICATION DIVISION.^Z^MiPROGRAM-ID. ?^Z."
(After pressing the key, give the program name.)
To define the CTRL/R key to prompt for the name of a BLISS routine, which it
will then find, use the following commmand:
DEFINE KEY CONTROL R AS "BR ADV 'ROUTINE ?'Routine name: ''."
+-------+-------+-------+-------+
This diagram defines | | | | |
the numbers of the | 20 | 10 | 11 | 12 |
keypad keys on VT52 | | | | |
terminals for use in +-------+-------+-------+-------+
the DEFINE KEY | | | | |
command. | 7 | 8 | 9 | 13 |
| | | | |
+-------+-------+-------+-------+
| | | | |
| 4 | 5 | 6 | 14 |
| | | | |
+-------+-------+-------+-------+
| | | | |
| 1 | 2 | 3 | 15 |
| | | | |
+-------+-------+-------+-------+
| | | |
| 0 | 16 | 21 |
| | | |
+---------------+-------+-------+
+-------+-------+-------+-------+ +-------+-------+-------+-------+
| | | | | | | | | |
| 12 | 13 | 15 | 14 | | 20 | 10 | 11 | 17 |
| | | | | | | | | |
+-------+-------+-------+-------+ +-------+-------+-------+-------+
| | | | |
This diagram defines the numbers | 7 | 8 | 9 | 18 |
of the keypad keys on VT100 | | | | |
terminals for use in the command. +-------+-------+-------+-------+
| | | | |
| 4 | 5 | 6 | 19 |
| | | | |
+-------+-------+-------+-------+
| | | | |
| 1 | 2 | 3 | |
| | | | |
+-------+-------+-------+ 21 |
| | | |
| 0 | 16 | |
| | | |
+---------------+-------+-------+
The DEFINE MACRO (abbreviated DEF M) command defines line mode macro commands.
Format: DEFINE MACRO name
The name is the name of the text buffer in which the macro is stored. The
macro itself is a series of EDT line-mode commands.
Invoke the macro by giving its name in response to the line mode prompt.
The DELETE (abbreviated D) command deletes the lines specified by the range.
Format: DELETE [range] [/QUERY]
If you do not specify the range, the default is the current line.
When you use the QUERY (abbreviated /Q) qualifier, EDT prompts you with a
question mark (?) to verify each line to be deleted.
Format: /QUERY
Responses are:
Y Yes, delete this line
N No, do not delete this line
Q Quit, do not delete any of the rest of the lines
A All, delete all the rest of the lines
The EXIT (abbreviated EX) command terminates all action in the editor and
saves a copy of the MAIN text buffer in the output file.
Format: EXIT [file-spec] [/SAVE] [/GO]
If you omit the file specification, the output file name from the command line
that invoked EDT is used. If no output file name has been specified, and if
/READONLY and /NOOUTPUT have not been specified, then the input file name is
used.
When you use the /SAVE (abbreviated /S) qualifier, the journal file is saved.
The journal file is called 'name.JOU', where name is the output file name from
the command line. For information about the journal facility, see HELP
JOURNAL.
When you use the /GO option (abbreviated /G), the last load class command used
before entering EDT will be re-executed. These commands are COMPILE, DEBUG,
EXECUTE, and LOAD. This simplifies the task of editing and testing new
programs.
Format: /GO
The FILL (abbreviated FIL) command reformats a block of text so that there are
as many full words on a line as possible without exceeding the right margin.
Format: FILL [range]
The lines in the range must be contiguous. If you omit the range, the select
range is assumed.
The right margin is set by the SET WRAP command. If the margin has not been
set, the default is the terminal width minus 1.
The FIND (abbreviated F) command places the cursor at the first line specified
by range.
Format: FIND [range]
The located line is not typed. To find and type a line, use the TYPE command.
Ex: F =X Returns EDT's attention to buffer X, to the line EDT was on when it
last left buffer X.
The INCLUDE (abbreviated INC) command copies external files into text buffers.
Format: INCLUDE file-spec [range]
The specified file is copied to the location before the first line of the
range. Note that range specifies the position to which the file will be
copied; it does not restrict the portion of the file which will be included.
To include part of a file, first INCLUDE the file into a buffer, then COPY
text from the buffer.
The INSERT (abbreviation: I) command inserts new text into a text buffer.
Format: INSERT [range] [\line to be inserted]
The new text is inserted before the first line specified by range. If you
omit range, new text is inserted just before the line at which the cursor is
located.
If you do not use the optional backslash, the editor enters insert mode. In
insert mode, you can enter as many lines of text as you wish, terminating each
line with a carriage return. Terminate insert mode by typing CTRL/Z.
If you choose the optional backslash, the text on the line following the
backslash is inserted and the editor does not enter insert mode. This is the
only form of the INSERT command that should be used in a startup file or
macro.
The line following the last line inserted becomes the current line.
EDT saves all input from the terminal during an editing session in a file
called the journal file. The journal file is deleted when you exit the editor
with an EXIT command or a QUIT command (without the /SAVE option). If the
editor is left involuntarily, the journal file is saved.
The journal file can be used to redo all the operations of an editing session.
The edited file is thereby recreated. Type the same command line used
previously with the addition of the /RECOVER qualifier.
Unless explicitly overridden by the /JOURNAL qualifier on the command line,
the journal file will have the same name as the output file, except that the
file type will be JOU.
The MOVE (abbreviated M) command moves text from one location to another,
deleting it from the original location.
Format: MOVE [range-1] TO [range-2] [/QUERY]
The lines specified by range-1 are moved to a location immediately before the
first line specified by range-2. The lines are deleted from the original
location. If you omit either of the range specifications, the current line is
used. The first line of range-2 becomes the new current line. To move lines
of text without deleting them from the original location, see the COPY
command.
When you use the QUERY (abbreviated /Q) qualifier, EDT prompts you with a
question mark (?) to verify each line to be moved.
Format: /QUERY
Responses are:
Y Yes, move this line.
N No, do not move this line.
Q Quit, do not move any of the rest of the lines.
A All, move all the rest of the lines.
The PRINT (abbreviated PR) command creates a listing file with the specified
file name.
Format: PRINT file-spec [range]
The lines selected by range are written to a listing format file with page
headers. If the NUMBERS option is set (see SET NUMBERS), the EDT line numbers
will appear on the listing. If you omit range, the entire current buffer is
printed. Print does not alter the current line. Use PRINT only to create a
listing. If you wish to create a file, use the WRITE command.
The PUSH (abbreviated PU) command temporarily transfers control to system
level without disturbing the editing session. Any system command can be
executed, but you should not attempt to edit the same file. To return to the
editing session type POP.
The QUIT command exits the editor without saving the contents of the MAIN
buffer. The QUIT command cannot be abbreviated.
Format: QUIT [/SAVE]
Use the QUIT command only if you have made no changes to the buffer you are
editing or if you have decided you do not wish to save the changes you have
made. All edits will be discarded when you QUIT from the editor.
The SAVE qualifier specifies that the journal file should be saved. Normally,
the journal file is deleted when you QUIT.
Range specifications select the exact lines of text on which the line editing
command will operate.
There are several general classes of range specifications:
1. Single line ranges specify a single line of text.
2. Multiple line ranges specify blocks of text, such as an entire buffer
or all lines from the current line to the end of the buffer.
3. Compound ranges combine single line ranges with operators to specify
multiple lines of text.
4. Noncontiguous ranges specify multiple lines that are not necessarily
adjacent to one another.
The ALL range further refines a general range specification.
Format: [range] ALL "string"
While range can be a single, multiple, or compound range, the command being
performed will only apply to those lines of text containing the given string.
This string must be enclosed in double quotes.
Ex: TYPE ALL "EDT" When ALL is used, the default for range is
WHOLE. This command will type all the lines in
the current buffer containing the string "EDT".
SUBS/A/B/50:100 ALL "1" Substitute B for A in lines from 50 to 100 which
include the string 1.
The AND range selects a group of single lines.
Format: range-1 AND range-2 AND range-3 ... or
range-1 , range-2 , range-3
Each of the ranges must be a single line range. Each of the single lines is
operated on.
Ex: TYPE 4 AND 7 Lines 4 and 7 are displayed on the terminal
TYPE BEGIN,END-1 The first and last lines are displayed on the terminal
The BEGIN range (abbreviated B) is a single line range that specifies the
first line in the buffer.
The BEFORE range (abbreviated BEF) is a multiple line range that specifies all
the lines in the buffer preceding the current line.
The BUFFER (abbreviated BU) specification may precede any other range
specification and indicates that the range is to be applied to a named buffer.
Format: BUFFER name [range] or
=name [range]
The two forms are equivalent. Name is the name of the buffer in which the
text resides. If you leave out the range, the entire buffer is selected.
The dot (.) is a single line range that refers to the current line of text.
For many commands, dot is the default range. See the help text for a command
if you are unsure of the default.
Ex: TYPE . Type the current line.
The END (abbreviated E) range specifies an imaginary line following the last
line in the buffer. END does not specify the last line in the buffer. The
last line can be referred to by E-1 (that is, the line preceding END). When
the END line is typed, it looks like:
[EOB]
The FOR range is a multiple line range that selects a specified number of
lines starting at a specified location.
Format: [range] FOR n or
[range] # n
The two forms are equivalent. Range is a single line range that specifies the
starting position, and n is an integer number. If range is omitted, the
current line is the starting position.
Ex: TYPE . FOR 5 Type 5 lines, starting with the current line
TYPE #5 Equivalent to the previous example
TYPE BEGIN FOR 10 Type the first 10 lines in the buffer
The LAST (abbreviated L) range is a single line range that refers to the line
in a previous buffer which was the current line when you switched to the
current buffer.
The minus sign (-) in ranges selects a single line that is a specified number
of lines before a specified line.
Format: [range] - [n]
Range is a single line range, and n is an integer. The line selected is the
line that is n lines before the line specified by range. If you omit range,
the current line is used; if you omit n, 1 is used.
Ex: TYPE 15 - 3 Type the third line before the line numbered 15.
TYPE END -1 Type the last line in the buffer.
TYPE - Type the previous line.
A line number is a single line range that refers to the line having the
specified number. The line number may contain a decimal point.
Ex: TYPE 10 Type line number 10.
INSERT 65.3 Insert before line 65.3.
The maximum allowable line number is 45035996273. A line number may have up
to five digits to the right of the decimal point.
You can change the line number with the RESEQUENCE command. In addition, the
INSERT and INCLUDE commands will automatically change the numbers of existing
lines if necessary to make each line in a buffer to have a line number larger
than the previous line.
When lines are read from the primary input file and that file has sequence
numbers, the line number assigned is the sequence number from the file, plus
N*100000, where N is large enough to ensure that each line in the buffer has a
line number larger than the previous line. File sequence numbers range in
value from 0 to 99999.
Format: ORIGINAL n
The ORIGINAL (abbreviated O) range is no longer a feature of EDT. The keyword
ORIGINAL is ignored; the number specified is taken as an editing line number.
See HELP RANGE NUMBER for more information.
The plus sign selects, in ranges, a single line that is a specified number of
lines after a specified line.
Format: [range] + [n]
Range is a single line range, and n is an integer. The line selected is the
line that is n lines after the line specified by range. If you omit range,
the current line is used. If you omit n, 1 is used.
Ex: T 15 + 3 Type the third line after the line numbered 15.
T BEGIN +1 Type the second line in the buffer.
T + Type the line following the current line.
T "string"+2 Type the second line following the next line containing
"string".
The REST (abbreviated R) range is a multiple line range that refers to the
current line and all lines following in the buffer.
The SELECT range is a multiple line range that contains all lines between the
current line and the SELECT mark. The SELECT mark is set by the change mode
SEL subcommand.
A quoted string specifies a single line that contains the specified string.
You must enclose the string in double quotes ("). When you use a string as a
range, EDT will search forward, starting with the current line, until it
locates a line with the specified string. If a minus sign (-) precedes the
string, the search will be backward.
Ex: T "abc" Locate and type the first line forward that contains the
string "abc".
T -"abc" Same, except the search will be backward.
The THRU range is a compound range that specifies all lines between two single
line ranges.
Format: range-1 THRU range-2 or
range-1 : range-2
Both forms are equivalent. Starting with range-1, EDT selects all the lines
up to and including the line specified by range-2.
Ex: TYP 15:30 Type all lines with numbers between 15 and 30.
TYP "glorp":END Type all lines from the first line forward containing
"glorp" to the end.
The WHOLE (abbreviated W) range refers to the entire text buffer.
The REPLACE (abbreviated R) command deletes the specified range of lines and
then places EDT in INSERT mode.
Format: REPLACE [range] [\text to insert]
When you do not specify a range, replace deletes the current line and inserts
the new text at that location.
If you do not use the optional backslash, the editor enters insert mode. In
insert mode you can enter as many lines of text as you wish, terminating each
line with a carriage return. You terminate insert mode by typing CTRL/Z.
If you use the optional backslash, EDT inserts the text in the command line
following the backslash and the editor does not enter insert mode. This is
the only form of the REPLACE command that should be used in startup files and
macros.
The line following the last line inserted becomes the current line.
The recognition feature of the TOPS-20 command parser may be used with
commands entered in line mode or on the initial command line. Two characters
are used to assist with command entry, these are query (?) and escape (ESC).
If you press query at the start of a field in a command, the system will list
the possible elements which may be entered at that point. For example:
Typing: res ?
Produces: res A valid range specification
res
If you press ESC part-way through a keyword or file specification the rest of
the entity and any appropriate guide words will be typed by the system. For
example:
Typing: res<ESC>
Produces: resEQUENCE (LINES IN THE RANGE)
The RESEQUENCE (abbreviated RES) command assigns new line numbers to a range
of lines.
Format: RESEQUENCE [range] [/SEQUENCE:init:incr]
The specified range of lines must be contiguous. When you do not specify a
range, all lines in the current buffer are resequenced. If the new numbers
assigned would cause duplicate or nonsequential line numbers, EDT will either
disallow the command or renumber lines beyond the specified range.
Note that the total count of lines resequenced (which is displayed upon
completion of the command), may differ from the number of lines originally
specified in the range, due to the possibility of extra renumbering.
The SEQUENCE (abbreviated /SEQ) qualifier specifies the sequence of numbers to
be assigned. The init parameter specifies the initial number, and incr
specifies the number by which the lines are incremented. If you do not use
the SEQUENCE qualifier, init and incr both default to 1.
The maximum allowable line number is 45035996273. If, during resequencing, a
line number plus 'incr' would exceed this value, that line and all remaining
lines will be numbered 45035996273. You should correct this immediately by
resequencing with a different 'init' and/or smaller 'incr'.
The SET (abbreviated SE) command sets options that control other editor
operations. Once set, these options are in effect throughout the rest of the
edit session or until changed by the SET command.
The SET AUTOREPEAT (abbreviated SE AUTOREPEAT) command enables EDT's use of
the DECARM VT100 control sequence to prevent keypad, function and arrow keys
from repeating faster than EDT can update the screen. If you do not want EDT
to manipulate the VT100's autorepeat feature, use SET NOAUTOREPEAT
(abbreviated SE NOAUTOREPEAT). On some VT100-class terminals, SET AUTOREPEAT
can cause the arrow keys to repeat at the rate of 2 per second rather than the
usual 30 per second. With SET NOAUTOREPEAT the arrow keys repeat faster, but
the screen is not be updated for each repeat of the arrow key, since EDT skips
intermediate updates if it gets behind.
On the VT100 with a printer port (not the VT102, which has its printer port
built in), SET NOAUTOREPEAT can cause the terminal to stop transmitting. If
this happens, you can fix it by clearing the keyboard buffer. To clear the
keyboard buffer, push the SET-UP key twice.
Format: SET [NO]AUTOREPEAT
Format: SET CASE { UPPER | LOWER | NONE }
Use the SET CASE (abbreviated SE CA) command on terminals which are capable of
displaying uppercase characters only. SET CASE instructs EDT to flag with a
preceding apostrophe either the uppercase characters, the lowercase
characters, or neither. The default for SET CASE is NONE, which means no
characters are flagged.
You can abbreviate the keywords as follows:
CASE CA
UPPER U
LOWER L
NONE N
Format: SET COMMAND file-specification
The SET COMMAND (abbreviated SE COM) command is used in a startup file to
specify the name of the next startup file to read. EDT provides a default
file type of ".EDT". If the file is not present this command does nothing;
otherwise it causes the current command file to be abandoned and the new one
to be read in its place.
When EDT starts up, it reads the installation-default startup file. The name
of the file is always EDTSYS. The default for the remainder of the file
specification is: SYS:.EDT.
When opening the file, EDT combines the name and the default name together
into a complete file specification.
The installation default initialization file should have SET COMMAND EDTINI at
its end, so that the user's initialization file will be read after the
installation default initialization file. IF EDTSYS is not found, EDT will
try again using the name EDTINI and default type .EDT, so there is no need for
an installation-default initialization file that just contains SET COMMAND
EDTINI.
Format: SET [NO]CONTROL-T
The SET CONTROL-T command makes CTRL/T available to EDT as a keypad mode
command character (normally used for tab operations). SET CONTROL-T may be
abbreviated to SE CON. SET CONTROL-T is the default.
SET NOCONTROL-T (abbreviated SE NOC) gives CTRL/T its usual system function of
reporting the status of the current program (EDT). In line mode, CTRL/T
always performs its status function.
Format: SET CURSOR top:bottom
The SET CURSOR (abbreviated SE CU) command, used with screen editing, sets the
limits within which the cursor is allowed to move without scrolling the
screen.
Top and bottom are the line numbers at the top of the screen and the bottom of
the screen. The line numbers must be in the range of 0 to 21, with 0
specifying the top line of the screen and 21 the bottom. The default setting
is 7:14, allowing the cursor to move within the middle third of the screen.
Format: SET ENTITY entity-type 'delimiter string'
Entity-type is one of the following:
WORD (abbreviation: W)
SENTENCE (abbreviation: S)
PAGE (abbreviation: PAG)
PARAGRAPH (abbreviation: PAR)
The SET ENTITY (abbreviated SE E) command sets the delimiters for the
user-defined change mode entities. For the WORD and SENTENCE entities, the
delimiter string is a set of single character delimiters. For PAGE and
PARAGRAPH, the delimiter is a character string that delimits the entity. See
HELP CHANGE ENTITIES for explanations of the entities.
If control characters are to be inserted into the string, they may be in the
form <XX> where XX must be in uppercase. The following are recognised: <LF>,
<VT>, <CR>, <FF>, <ESC>, and <DEL>.
Format: SET [NO]FNF
The SET FNF option controls whether or not an informative message is typed out
when you attempt to edit a non-existing file. NOFNF opens a new file but
gives no message.
Format: SET HELP [file-specification]
The SET HELP (abbreviated SE H) option lets you define which help file will be
accessed when you either give the HELP command or press the HELP KEY in keypad
mode. The default device and directory are always as listed below unless
overriden by an explicit device and directory. SET HELP without a file
specification returns you to the original default help file.
The default file specification for the help file is HLP:EDTHELP.HLB.
Format: SET [NO]KEYPAD
The SET KEYPAD (abbreviated SE K) option controls whether or not the editing
keypad is to be used when you are in CHANGE mode. KEYPAD is set by default
for VT100 and VT52 terminals, which means the alternate keypad is used to
enter change mode commands.
The SET LINES (abbreviated SE L) command controls the number of screen lines
used in either of the screen versions of change mode. Use this option to
reduce the time it takes to refresh the screen image when editing on slow
terminals.
Format: SET LINES n
where n is the number of lines to use. n must be between 1 and 22. By
default, n is set to 22 lines.
The SET MODE (abbreviated SE M) command determines which mode of editing
should be entered after all initial processing is complete. This command is
useful only in the startup command file.
Format: SET MODE { LINE | CHANGE }
By default, EDT enters line mode when the startup processing is complete. Use
SET MODE CHANGE in your startup file to cause EDT to enter change mode when
startup processing is complete.
Format: SET [NO]NUMBERS
The SET NUMBERS (abbreviated SE NU) command controls the typing of line
numbers on the terminal. Numbers are set on by default. If you want to
suppress numbers, use SET NONUMBERS (abbreviated NON).
Format: SET PARAGRAPH [NO]WPS
The SET PARA command specifies a paragraph as the text between two delimiters
and including any adjacent delimiters (WPS), or the text between two
delimiters (NOWPS).
Format: SET PROMPT prompt-type "string"
Where prompt-type is either LINE, KEYPAD, NOKEYPAD, HCCHANGE, INSERT, INSERTN,
or QUERY.
The SET PROMPT command allows redefinition of the prompt string that is
displayed in line mode, in keypad mode, in nokeypad mode, in hardcopy change
mode, in line mode when inserting, in line mode when inserting with NONUMBERS,
and with the /QUERY qualifier.
Use of this command is not recommended. If SET PROMPT is used, note that EDT
will become confused if the new string for the keypad or nokeypad prompt
causes a net motion of the cursor.
If control characters must be inserted into the string, they may be in the
form <XX> where XX must be in uppercase. The following are recognised: <LF>,
<VT>, <CR>, <FF>, <ESC>, and <DEL>.
The SET QUIET (abbreviated SE Q) command controls whether or not the bell will
sound when an error is made in change mode.
Format: SET [NO]QUIET
The quiet option is off (meaning the bell will sound) by default.
The SET REPEAT (abbreviated SE REP) command enables you to use the GOLD key
followed by digits to represent a count. If you do not want the ability to
use counts, use SET NOREPEAT (abbreviated SE NOREP). A warning bell sounds if
you attempt to use counts with NOREPEAT set.
Format: SET [NO]REPEAT
By default, REPEAT is enabled.
The SET SCREEN (abbreviated SE SC) command controls the number of characters
displayed on a line.
Format: SET SCREEN w
where w is the width of the screen line. By default, the screen width is set
to the terminal's width, as reported to EDT by the operating system.
The SET SEARCH (abbreviated SE SE) command controls several options related to
string searching.
Format: SET SEARCH { GENERAL | EXACT | WPS |
CASE INSENSITIVE | CI }
{ [UN]BOUNDED }
{ BEGIN | END }
The GENERAL option will cause the case of letters and the presence or absence
of diacritical marks to be ignored in search strings. GENERAL is the default.
The EXACT option will require all characters to match exactly, including the
case of letters and the presence of diacritical marks, in search strings.
The WPS option will cause a case-independent string match for lowercase
letters in the search string, and a case-dependent match for uppercase letters
in the search string.
The CI option will cause the case of letters to be ignored in search strings,
but not the presence of diacritical marks. CI is an abbreviation for CASE
INSENSITIVE.
The BOUNDED (abbreviated BO) option will cause the search to be bounded by a
page delimiter. By default, the search is unbounded, which means that the
entire buffer will be searched. This option has effect only in change mode.
The UNBOUNDED (abbreviated U) option causes the search not to be bounded by a
page delimiter, which means that the entire buffer will be searched. This is
the default. This option has effect only in change mode.
The BEGIN (abbreviated B) option causes the cursor to be left at the beginning
of the search string when it is found. This is the default. This option has
effect only in change mode.
The END (abbreviated E) option causes the cursor to be left at the end of the
search string when it is found. By default, the cursor is left at the
beginning. This option has effect only in change mode.
The SET [NO]SUMMARY command controls whether or not summary information about
a file written with the WRITE or EXIT commands will be typed out. The default
is SUMMARY, which means that summary information is typed.
Format: SET [NO]SUMMARY
The SET TAB (abbreviated SE TA) command enables the structured tab feature and
sets the logical tab size.
Format: SET [NO]TAB n
where n is the number of columns in a logical tab stop.
With the structured tab feature, EDT keeps a counter of the tab level, which
is set to 1 when the SET TAB command is issued. When you use the tab key in
change mode at the beginning of a line, EDT inserts enough tabs and spaces to
move the cursor to the column defined by the level n times the tab size.
Change mode subcommands can alter the tab level. The structured tab feature
is disabled by default.
The tab size set by the tab command is also used by the TABS ADJUST command.
Format: SET TERMINAL { HARDCOPY | HCPY | VT100 | VT52 }
{ SCROLL | NOSCROLL }
{ EDIT | NOEDIT }
The SET TERMINAL (abbreviated SE TE) command identifies to EDT the type of
terminal you are using. Normally, EDT will set the terminal type by asking
the operating system what type it is. If it does not appear to have set the
type correctly, you can use the SHOW TERMINAL command to see what EDT thinks
your terminal is and the SET TERMINAL command to correct it if necessary. If
your terminal is not a VT100 or a VT52, it should be set to HCPY (hardcopy).
HCPY stands for hardcopy. EDT considers a terminal hardcopy if it is not a
VT100 or a VT52. On such terminals change mode does not use the screen as a
window onto your buffer, but instead shows you the current line with the
cursor position indicated. You type NOKEYPAD commands and EDT will keep you
informed by printing the current line after each command.
The VT100 is a family of terminals, all based on the original VT100 terminal.
This class of terminals includes the VT101, VT102, VT125, VT131 and VT132.
The VT52 terminal is the predecessor of the VT100 family. It does not have
reverse video, and has fewer keys in its keypad.
This option indicates that your terminal has scrolling regions and EDT may use
them. This is the default for most VT100 terminals.
This option indicates that either your terminal does not have scrolling
regions or EDT should not use them. This is the default for VT52 terminals.
This option indicates that your terminal has the screen editing features of
the VT102. These are IL (insert line), DL (delete line), ICM (insert
character mode) and DCH (delete characters).
This option indicates that your terminal does not have the screen editing
features of the VT102.
Format: SET TEXT text-type "string"
Text-type is one of the following:
PAGE
END
The SET TEXT command allows you to define the displayed string to indicate a
formfeed character (SET TEXT PAGE), and the displayed string to indicate the
end of the buffer (SET TEXT END). The string can not contain control or
escape characters.
The SET TRUNCATE (abbreviated SE TR) command controls the handling of long
lines in change mode.
Format: SET [NO]TRUNCATE
By default, truncate mode is set, which means long lines will be truncated on
the display (the actual text is not altered). If you turn off truncate mode
by using SET NOTRUNCATE, long lines will be wrapped to as many screen lines as
are necessary to display the entire line.
The SET VERIFY (abbreviated SE V) command controls the listing of commands
that are executed from the startup file or from a macro.
Format: SET [NO]VERIFY
Verify is off by default, which means the lines are not typed. If you turn it
on, each command line is typed as it is executed.
Format: SET WORD [NO]DELIMITER
The SET WORD (abbreviated SE W) command enables you to specify that the word
delimiters be considered words by themselves (NODELIMITER), or considered as
part of the word they delimit (DELIMITER). The default is DELIMITER.
Format: SET [NO]WRAP n
The SET WRAP (abbreviated SE W) command enables word wrapping and specifies
the right margin. Word wrapping is a feature of EDT that automatically insert
carriage returns when the text you are typing exceeds the right margin. Word
wrapping is in effect in change mode only and only if you have used the SET
WRAP command.
The SET WRAP command also sets the right margin for the change mode FILL
subcommmand.
SET NOWRAP (abbreviated SE NOW) disables the word wrapping feature.
Format: SHOW parameter
The SHOW (abbreviated SH) command displays selected information on the current
state of the editor. Parameter is one of the additional topics listed below.
Format: SHOW AUTOREPEAT
The SHOW AUTOREPEAT command displays whether EDT is allowed to manipulate the
Autorepeat feature of VT100-type terminals or not. See SET AUTOREPEAT for
more information.
Format: SHOW BUFFER
The SHOW BUFFER (abbreviated SH BU) command lists the buffers being used
during the edit session, including the number of lines of text in each buffer.
The current buffer is marked by an equal sign (=) before the name. If an
asterisk follows the number of lines, it indicates that an input file is
connected to the buffer and that there are more lines to be read from the
file. Thus, the line count is not accurate.
Format: SHOW CASE
The SHOW CASE (abbreviated SH CA) command shows the current case setting
(upper, lower, or none).
Format: SHOW COMMAND
The SHOW COMMAND (abbreviated SH COM) command shows the name of the last
specified command file. When EDT starts to read a startup file specified by
SET COMMAND it clears this name. For more information see HELP SET COMMAND.
CONTROL-T
Format: SHOW CONTROL-T
The SHOW CONTROL-T (abbreviated SH CON) command shows the current state of the
CTRL/T character. If the response is "Control-t" the CTRL/T is available to
EDT as a keypad mode command character. Otherwise, CTRL/T performs its usual
status reporting function.
Format: SHOW CURSOR
The SHOW CURSOR (abbreviated SH CU) command shows the current setting of the
cursor region. EDT will respond with:
t:b
where t and b are integer numbers indicating the top and bottom of the cursor
region. See HELP SET CURSOR for an explanation of the cursor region.
Format: SHOW ENTITY entity-type
where entity type is one of the following:
WORD (abbreviation: W)
SENTENCE (abbreviation: S)
PAGE (abbreviation: PAG)
PARAGRAPH (abbreviation: PAR)
The SHOW ENTITY (abbreviated SH EN) command displays the current delimiter
string for the specified entity.
Format: SHOW FILES
The SHOW FILES (abbreviated SH FI) command displays the name of the input and
output files which were specified in the EDT command line. If no output file
was specified, then the input file name is also used as the output file name.
If /NOOUTPUT or /READONLY was specified in the command line, then this will be
indicated in place of the output file name.
If an output file was not specified in the command which initiated the editor,
then the output filespec will be the same as the input filespec. The
generation number will be changed during the EXIT command to the next higher
one.
Format: SHOW FNF
The SHOW FNF command displays whether the file not found message is enabled or
disabled.
Format: SHOW HELP
The SHOW HELP (abbreviated SH H) command shows the currently active default
help file specification and help file name. Use the SET HELP command to
redefine the help file name.
The SHOW KEY (abbreviated SH K) command displays the current definition of a
keypad or control key.
Format: SHOW KEY key-selector
Where key-selector is one of the following: (alternatives separated by "|")
[GOLD] number | [GOLD] CONTROL letter | [GOLD] CONTROL "letter"
[GOLD] CONTROL letter | GOLD character | GOLD "character" | GOLD 'character'
[GOLD] DELETE | [GOLD] FUNCTION number
Number refers to keypad and function keys and CONTROL letter names specific
control keys (upper and lowercase letters are considered equivalent). DELETE
refers to the delete character, which is not a control character. Character
refers to any keyboard key except 0-9. Characters !, %, ', and " must be
enclosed in quotes.
For the meaning of the string printed by the SHOW KEY command, see HELP DEFINE
KEY.
Format: SHOW KEYPAD
The SHOW KEYPAD (abbreviated SH KEYP) command shows the current setting for
the option of using keypad editing when you are in change mode. KEYPAD is the
default for VT100 and VT52 terminals, which means that the alternate keypad is
used to enter change mode commands. The option can be changed by using the
SET [NO]KEYPAD command.
Format: SHOW LINES
The SHOW LINES (abbreviated SH L) command shows the current number of screen
lines displayed in change mode. Use the SET LINES command to modify this
setting.
Format: SHOW MODE
The SHOW MODE (abbreviated SH M) command shows the current setting of the
default editing mode. It indicates the editing mode that is entered after all
startup processing. By default, EDT enters line mode when the startup
processing is complete. Use SET MODE CHANGE in your startup file to cause EDT
to enter change mode at the end of startup processing.
Format: SHOW NUMBERS
The SHOW NUMBERS (abbreviated SH NU) command shows the current setting for the
option of displaying line numbers on the terminal. Numbers are displayed by
default. Use SET NONUMBERS to suppress the line numbers.
Format: SHOW PARAGRAPH
The SHOW PARAGRAPH (abbreviated SH PARA) command shows the current setting for
delimiting paragraphs. By default a new paragraph begins after two successive
linefeeds. Use SET PARAGRAPH WPS to indicate that a new paragraph begins at
the first non-linefeed character after two successive linefeeds.
Format: SHOW PROMPT prompt-type
Where prompt-type is one of: LINE, KEYPAD, NOKEYPAD, HCCHANGE, INSERT,
INSERTN, or QUERY.
The SHOW PROMPT command shows the current string to be used when prompting in
line mode, in keypad change mode, in nokeypad change mode, in hardcopy change
mode, in line mode when inserting, in line mode when inserting with NONUMBERS,
and in response to /QUERY, respectively.
Format: SHOW QUIET
The SHOW QUIET (abbreviated SH Q) command shows the current setting of the
option that controls whether or not the bell sounds when you make an error in
change mode. You can change this option with the SET [NO]QUIET command.
Format: SHOW REPEAT
The SHOW REPEAT (abbreviated SH REP) command shows whether or not counts are
allowed. The default is to allow counts. To disable counts use SET NOREPEAT.
Format: SHOW SCREEN
The SHOW SCREEN (abbreviated SH SC) command shows the current setting for the
maximum length of a line EDT displays.
Format: SHOW SEARCH
The SHOW SEARCH (abbreviated SH SE) command shows the current search
parameters. See HELP SET SEARCH for a description of search options.
Format: SHOW SUMMARY
The SHOW SUMMARY command shows whether the file summary on WRITE and EXIT is
enabled or disabled.
Format: SHOW TAB
The SHOW TAB (abbreviated SH TA) command shows the current settings for the
structured tab feature. If structured tabs are enabled, the tab size and
indentation level are displayed.
For additional information on the structured tab feature, see HELP SET TAB and
HELP TAB.
Format: SHOW TERMINAL
The SHOW TERMINAL (abbreviated SH TE) command shows your terminal type:
VT100, VT52 or Hardcopy. It also shows whether or not your terminal has
scrolling regions, eight-bit graphics and the advanced screen editing
features. See SET TERMINAL for more information.
Format: SHOW TEXT text-type
where text-type is one of the following:
END
PAGE
The SHOW TEXT command shows the current string to be used for displaying
formfeeds or the end of buffer.
Format: SHOW TRUNCATE
The SHOW TRUNCATE (abbreviated SH TR) command shows the current setting of the
option for displaying long lines in change mode. The default is TRUNCATE,
which means that lines longer than the screen width are truncated on the
display (the actual text is not altered). If you turn off this option by
entering SET NOTRUNCATE, long lines are wrapped to as many screen lines as are
necessary to display the entire screen.
Format: SHOW VERIFY
The SHOW VERIFY (abbreviated SH VERI) command displays the current setting of
the option to list commands that are executed from the startup file or a
macro. By default, verify is off, which means that the lines are not typed.
If you turn it on, each such command is typed as it is executed.
Format: SHOW VERSION
The SHOW VERSION (abbreviated SH VE) command displays the version number and
copyright statement of EDT. You should write the full text of the version
number on any EDT SPR. The copyright statement appears as:
COPYRIGHT (C) DIGITAL EQUIPMENT CORPORATION 1980, 1982
Format: SHOW WORD
The SHOW WORD (abbreviated SH WO) command shows the current setting for the
handling of word delimiters. The default is to consider all delimiters with
the exception of a space a word. To disable this use SET WORD NODELIMITER.
Format: SHOW WRAP
The SHOW WRAP (abbreviated SH WR) command shows the current setting of the
right margin for word wrapping.
Word wrapping is a feature of EDT that automatically inserts carriage returns
when the text you are typing exceeds the right margin. The same margin is
used for the change mode FILL subcommand. Word wrapping is in effect in
change mode only and only, if you have used the SET WRAP command.
The SUBSTITUTE (abbreviated S) command replaces occurrences of one string of
characters with another string.
Format: SUBSTITUTE/string-1/string-2/ [range] [/BRIEF[:n]] [/QUERY] [/NOTYPE]
Any nonalphanumeric character except % can be used as string delimiters.
All occurrences of string-1 within the specified range are replaced with
string-2. If you do not specify range, a single occurrence in the current
line is substituted. The line in which the substitution occurred is typed
after each substitution.
When you select the /BRIEF (abbreviated /BR) option, only the first n
characters of the line are displayed. If you omit n, the default is 10.
When you specify /NOTYPE (abbreviated /NOT) the lines in which substitutions
occurred are not typed.
The SUBSTITUTE NEXT (abbreviated N) command replaces the next occurrence of
string-1 with string-2.
Format: [SUBSTITUTE] NEXT [/string-1/string-2/]
The search for string-1 is made forward from the current location. When a
substitution is made, the line where the substitution occurs becomes the
current line. When the optional strings are omitted, the strings used in the
last SUBSTITUTE or SUBSTITUTE NEXT command are used.
Format: /QUERY
When you use the QUERY (abbreviated /Q) qualifier, EDT prompts you with a
question mark (?) to verify each substitution.
Responses are:
Y Yes, do the substitution.
N No, do not do the substitution.
Q Quit, terminate the command.
A All, do the rest of the substitutions without query.
The TAB ADJUST (abbreviated TA A) command shifts each of a range of lines a
specified number of logical tab stops.
Format: TAB ADJUST [-] n [range]
where n is the number of tab stops to shift. You must use the SET TAB command
to set the logical tab size in order for this command to work. If you omit
range, the select range is assumed. If a minus sign (-) precedes the count n,
the text shifts to the left. Otherwise, it shifts to the right.
The TYPE (abbreviated T) command displays the specified range of lines on the
terminal.
Format: TYPE [range] [/BRIEF[:n]] [/STAY]
The first line in the specified range becomes the current line.
If the range specification starts with a nonalphabetic character, the keyword
TYPE may be omitted completely.
Format: /BRIEF[:n]
When you select the /BRIEF (abbreviated /BR) option, only the first n
characters of the line are displayed. If you omit n, the default is 10.
Format: /STAY
When you select the /STAY (abbreviated /ST) option, the cursor position is not
changed by the TYPE command. This enables you to look at text elsewhere in
the buffer (or in another buffer) without losing your position.
The WRITE (abbreviated WR) command creates a file from a specified range of
lines.
Format: WRITE file-spec [range]
When you specify a range, the text contained in that range becomes the file.
When you do not specify a range, the contents of the current text buffer
becomes the new file. The cursor position is not affected by the WRITE
command.